BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0646 (464 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF100669-1|AAK39265.1| 931|Caenorhabditis elegans Hypothetical ... 33 0.13 U50312-3|AAA92320.2| 494|Caenorhabditis elegans Hypothetical pr... 29 1.6 >AF100669-1|AAK39265.1| 931|Caenorhabditis elegans Hypothetical protein R11E3.3 protein. Length = 931 Score = 32.7 bits (71), Expect = 0.13 Identities = 14/40 (35%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Frame = -1 Query: 131 MILGDFNSHHTSWGSSVS-NSYGYELLDILDMYSLCILNS 15 +I GD N+HH++W S S ++ G EL +++D++ I+ + Sbjct: 35 IISGDVNAHHSAWHSEGSEDTRGRELAELIDLHPDLIIQN 74 >U50312-3|AAA92320.2| 494|Caenorhabditis elegans Hypothetical protein B0222.3 protein. Length = 494 Score = 29.1 bits (62), Expect = 1.6 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Frame = -1 Query: 254 CFSVIAAIVDGICFVSIY--VPHPSLQIFNEIKNFISVLPRPFMILGDFNSHHTSWGSS 84 C I+ ++ GI IY V H L+ N +KN + LP + + FN+ W S Sbjct: 166 CSWFISPVLSGIISSIIYMIVDHTVLRTANPLKNGLRALPVFYFVCMAFNALMVFWDGS 224 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,551,243 Number of Sequences: 27780 Number of extensions: 189975 Number of successful extensions: 483 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 477 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 483 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 829055604 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -