BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0645 (694 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g38396.1 68418.m04641 F-box family protein contains F-box dom... 29 3.9 At3g02590.1 68416.m00250 delta 7-sterol-C5-desaturase, putative ... 29 3.9 At3g02580.1 68416.m00249 delta 7-sterol-C5-desaturase (STE1) ide... 28 5.1 >At5g38396.1 68418.m04641 F-box family protein contains F-box domain Pfam:PF00646 Length = 462 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +1 Query: 466 FWLFRNNLCYTSNWVLGFIV*AHHIFTVGIAIDTRGIFYFSYYKY 600 FW SN L + + +I++ I+ DT + YFS++KY Sbjct: 200 FWFTTFTDVTVSNPSLKTLTMSSNIYSGSISFDTPSLVYFSHFKY 244 >At3g02590.1 68416.m00250 delta 7-sterol-C5-desaturase, putative similar to delta7 sterol C-5 desaturase GI:5031219 from [Arabidopsis thaliana] Length = 279 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +1 Query: 295 NRSKLKYIIF*SCWRRRPNFISTFILIFWTS*SLYFNFTRIWYNFSYY 438 NR L +++ + W P+F+ T++ + LYF +W + YY Sbjct: 20 NRMVLSHLLPVNLWEPLPHFLQTWLRNYLAGNILYFISGFLWCFYIYY 67 >At3g02580.1 68416.m00249 delta 7-sterol-C5-desaturase (STE1) identical to sterol-C5-desaturase GB:AAD12944 GI:4234768 from [Arabidopsis thaliana] Length = 281 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +1 Query: 295 NRSKLKYIIF*SCWRRRPNFISTFILIFWTS*SLYFNFTRIWYNFSYY 438 NR L +++ + W P+F+ T++ + LYF +W + YY Sbjct: 19 NRIVLSHLLPANLWEPLPHFLQTWLRNYLAGTLLYFISGFLWCFYIYY 66 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,258,177 Number of Sequences: 28952 Number of extensions: 219552 Number of successful extensions: 397 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 397 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1477286152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -