BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0636 (707 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 23 2.4 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 23 3.2 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 23 3.2 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 23.0 bits (47), Expect = 2.4 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 4/52 (7%) Frame = -1 Query: 698 EPWRYTPFSTVGAPERSYFPFHILLVG----ILS*INRKVISSNAPIPNPIV 555 +P + PF+TVGA ++ F LVG L + +V+ S + N ++ Sbjct: 194 KPPQAPPFATVGANLQATVSFGTNLVGGIVRSLGTLGSRVVESGTKLANMVI 245 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 22.6 bits (46), Expect = 3.2 Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +3 Query: 153 VIDIIASHL-VSIFNDCIKCGVFPDLMKHSKVIPLLNLVVLMT-PLTIDLFQY 305 V+ + SH ++ + C+ VFP H L +V++ PL + +F Y Sbjct: 188 VVFHVESHPNITWYQQCVTYNVFP-TYAHELTYLLFGMVMMYALPLAVIIFSY 239 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 22.6 bits (46), Expect = 3.2 Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +3 Query: 153 VIDIIASHL-VSIFNDCIKCGVFPDLMKHSKVIPLLNLVVLMT-PLTIDLFQY 305 V+ + SH ++ + C+ VFP H L +V++ PL + +F Y Sbjct: 188 VVFHVESHPNITWYQQCVTYNVFP-TYAHELTYLLFGMVMMYALPLAVIIFSY 239 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,186 Number of Sequences: 336 Number of extensions: 3574 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18738900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -