BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0636 (707 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_31876| Best HMM Match : RVT_1 (HMM E-Value=0) 77 1e-14 SB_38806| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_10718| Best HMM Match : RVT_1 (HMM E-Value=2.3e-33) 77 1e-14 SB_10470| Best HMM Match : Herpes_UL33 (HMM E-Value=1.8) 71 1e-12 SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34) 70 2e-12 SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) 69 3e-12 SB_26585| Best HMM Match : RVT_1 (HMM E-Value=0) 69 3e-12 SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) 69 3e-12 SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) 69 3e-12 SB_8605| Best HMM Match : RVT_1 (HMM E-Value=0) 69 3e-12 SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 3e-12 SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) 69 3e-12 SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 7e-12 SB_27420| Best HMM Match : PHB_acc (HMM E-Value=6.6) 68 9e-12 SB_14797| Best HMM Match : RVT_1 (HMM E-Value=7.9e-33) 68 9e-12 SB_11851| Best HMM Match : IncFII_repA (HMM E-Value=1.4) 68 9e-12 SB_8080| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_11746| Best HMM Match : RVT_1 (HMM E-Value=5e-31) 67 2e-11 SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_6009| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_34368| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 6e-11 SB_7972| Best HMM Match : RVT_1 (HMM E-Value=5.8e-29) 64 1e-10 SB_38467| Best HMM Match : RVT_1 (HMM E-Value=4.2e-05) 64 1e-10 SB_43683| Best HMM Match : RVT_1 (HMM E-Value=0.024) 63 2e-10 SB_9604| Best HMM Match : Cbl_N3 (HMM E-Value=1.2) 63 2e-10 SB_3992| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_4171| Best HMM Match : Cbl_N3 (HMM E-Value=1.2) 63 2e-10 SB_39089| Best HMM Match : RVT_1 (HMM E-Value=2.2e-20) 62 4e-10 SB_38898| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 62 4e-10 SB_32540| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 62 4e-10 SB_22988| Best HMM Match : RVT_1 (HMM E-Value=5.70328e-43) 62 4e-10 SB_21614| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-41) 62 4e-10 SB_1476| Best HMM Match : RVT_1 (HMM E-Value=5.49309e-43) 62 4e-10 SB_57427| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00044) 62 4e-10 SB_48325| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_34884| Best HMM Match : RVT_1 (HMM E-Value=8.1e-25) 62 4e-10 SB_33122| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 62 4e-10 SB_23765| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_14369| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 62 4e-10 SB_10116| Best HMM Match : RVT_1 (HMM E-Value=2.5e-33) 62 4e-10 SB_4524| Best HMM Match : Ribosomal_S7e (HMM E-Value=0.59) 62 4e-10 SB_3348| Best HMM Match : Borrelia_orfA (HMM E-Value=0.71) 62 4e-10 SB_41511| Best HMM Match : SAP (HMM E-Value=2.7e-08) 61 7e-10 SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 7e-10 SB_25914| Best HMM Match : IL1_propep (HMM E-Value=8.1) 61 7e-10 SB_8360| Best HMM Match : RVT_1 (HMM E-Value=3.6e-07) 61 7e-10 SB_34832| Best HMM Match : SAP (HMM E-Value=1.4e-07) 61 1e-09 SB_15184| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_17488| Best HMM Match : Phi-29_GP3 (HMM E-Value=0.69) 60 1e-09 SB_30213| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 2e-09 SB_49613| Best HMM Match : Transposase_5 (HMM E-Value=0.033) 59 4e-09 SB_18971| Best HMM Match : PWP2 (HMM E-Value=4) 59 4e-09 SB_10046| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_13949| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_13020| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_9212| Best HMM Match : RVT_1 (HMM E-Value=4.5e-36) 54 9e-08 SB_1875| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_53688| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_48302| Best HMM Match : HORMA (HMM E-Value=1.1) 54 2e-07 SB_58397| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_54849| Best HMM Match : HORMA (HMM E-Value=0.54) 54 2e-07 SB_27891| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) 52 6e-07 SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) 51 8e-07 SB_8622| Best HMM Match : RVT_1 (HMM E-Value=1.8e-35) 51 8e-07 SB_4381| Best HMM Match : RVT_1 (HMM E-Value=3) 51 8e-07 SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_6973| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_31593| Best HMM Match : Ribonuclease_3 (HMM E-Value=6.30024e-42) 50 2e-06 SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40) 50 2e-06 SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) 50 2e-06 SB_22068| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_12012| Best HMM Match : DUF327 (HMM E-Value=2) 50 2e-06 SB_11753| Best HMM Match : RVT_1 (HMM E-Value=0) 50 2e-06 SB_798| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_36163| Best HMM Match : RVT_1 (HMM E-Value=4.2e-11) 50 2e-06 SB_27268| Best HMM Match : RVT_1 (HMM E-Value=2.24208e-44) 50 2e-06 SB_24534| Best HMM Match : RVT_1 (HMM E-Value=0) 50 2e-06 SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) 50 2e-06 SB_58171| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_39669| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_56454| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_53800| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_47788| Best HMM Match : Cir_Bir_Yir (HMM E-Value=8.6) 49 3e-06 SB_27170| Best HMM Match : RVT_1 (HMM E-Value=1.3e-31) 49 3e-06 SB_24501| Best HMM Match : RVT_1 (HMM E-Value=4.2e-37) 49 3e-06 SB_36088| Best HMM Match : RVT_1 (HMM E-Value=9e-12) 49 4e-06 SB_57858| Best HMM Match : RNA_pol_A_CTD (HMM E-Value=5.7) 49 4e-06 SB_1758| Best HMM Match : RVT_1 (HMM E-Value=0) 48 6e-06 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 48 6e-06 SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) 48 6e-06 SB_10781| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_34658| Best HMM Match : SUI1 (HMM E-Value=1e-06) 48 1e-05 SB_22968| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_14807| Best HMM Match : RVT_1 (HMM E-Value=2.2) 48 1e-05 SB_3017| Best HMM Match : RVT_1 (HMM E-Value=1.1e-19) 48 1e-05 SB_33293| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_30053| Best HMM Match : RVT_1 (HMM E-Value=2.3e-24) 47 1e-05 SB_31930| Best HMM Match : RVT_1 (HMM E-Value=1.3e-33) 47 1e-05 SB_24580| Best HMM Match : zf-C2H2 (HMM E-Value=0) 47 2e-05 SB_48125| Best HMM Match : RVT_1 (HMM E-Value=8.4e-38) 47 2e-05 SB_35000| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_59377| Best HMM Match : Exo_endo_phos (HMM E-Value=1.7) 46 2e-05 SB_59080| Best HMM Match : RVT_1 (HMM E-Value=1.2e-35) 46 2e-05 SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) 46 2e-05 SB_41718| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) 46 2e-05 SB_37650| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_35561| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00092) 46 2e-05 SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1) 46 2e-05 SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_19821| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) 46 2e-05 SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1) 46 2e-05 SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) 46 2e-05 SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) 46 2e-05 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 46 2e-05 SB_32334| Best HMM Match : UPF0058 (HMM E-Value=4.6) 46 2e-05 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 46 2e-05 SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) 46 2e-05 SB_17732| Best HMM Match : RVT_1 (HMM E-Value=1.5e-27) 46 2e-05 SB_6922| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) 46 2e-05 SB_3609| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_37633| Best HMM Match : DUF327 (HMM E-Value=2.1) 46 3e-05 SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) 46 3e-05 SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) 46 4e-05 SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) 46 4e-05 SB_41660| Best HMM Match : PyrI_C (HMM E-Value=4.6) 46 4e-05 SB_37835| Best HMM Match : RVT_1 (HMM E-Value=0) 46 4e-05 SB_37247| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_22944| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_5148| Best HMM Match : RVT_1 (HMM E-Value=1.7e-27) 46 4e-05 SB_576| Best HMM Match : RVT_1 (HMM E-Value=0) 46 4e-05 SB_52564| Best HMM Match : Exo_endo_phos (HMM E-Value=3.2e-09) 46 4e-05 SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) 46 4e-05 SB_30833| Best HMM Match : RVT_1 (HMM E-Value=3.50044e-42) 46 4e-05 SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) 46 4e-05 SB_53427| Best HMM Match : RVT_1 (HMM E-Value=0.031) 45 5e-05 SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_36120| Best HMM Match : zf-MIZ (HMM E-Value=3.9) 45 5e-05 SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) 45 5e-05 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 45 5e-05 SB_15607| Best HMM Match : zf-MIZ (HMM E-Value=3.9) 45 5e-05 SB_59500| Best HMM Match : RVT_1 (HMM E-Value=0.015) 45 5e-05 SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_20001| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) 45 5e-05 SB_39386| Best HMM Match : RVT_1 (HMM E-Value=7.1e-28) 45 7e-05 SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) 45 7e-05 SB_483| Best HMM Match : SAM_1 (HMM E-Value=2.4e-13) 45 7e-05 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_41708| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_20189| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_58610| Best HMM Match : RVT_1 (HMM E-Value=0.061) 44 9e-05 SB_28047| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_21047| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) 44 9e-05 SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_35188| Best HMM Match : RVT_1 (HMM E-Value=2.3e-25) 44 1e-04 SB_21074| Best HMM Match : NadA (HMM E-Value=2) 44 1e-04 SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8) 44 1e-04 SB_8909| Best HMM Match : LRR_2 (HMM E-Value=0.34) 44 1e-04 SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) 44 1e-04 SB_26005| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_18097| Best HMM Match : NadA (HMM E-Value=2.2) 44 1e-04 SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) 44 2e-04 SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) 44 2e-04 SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2) 44 2e-04 SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) 44 2e-04 SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) 44 2e-04 SB_6188| Best HMM Match : Transposase_23 (HMM E-Value=0.41) 44 2e-04 SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) 44 2e-04 SB_46483| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_33707| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 43 2e-04 SB_23472| Best HMM Match : HIT (HMM E-Value=0.43) 43 2e-04 SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0) 43 2e-04 SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028) 43 2e-04 SB_53096| Best HMM Match : PHD (HMM E-Value=0.001) 43 2e-04 SB_49562| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42434| Best HMM Match : RVT_1 (HMM E-Value=2.7e-18) 43 2e-04 SB_25064| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) 43 2e-04 SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_12041| Best HMM Match : PHD (HMM E-Value=0.001) 43 2e-04 SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0) 43 2e-04 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_10707| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40407| Best HMM Match : RVT_1 (HMM E-Value=9.4e-33) 43 3e-04 SB_26857| Best HMM Match : Viral_NABP (HMM E-Value=2.6) 43 3e-04 SB_24508| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58520| Best HMM Match : RVT_1 (HMM E-Value=0.035) 43 3e-04 SB_57813| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_43483| Best HMM Match : RVT_1 (HMM E-Value=9.4e-33) 43 3e-04 SB_41552| Best HMM Match : RVT_1 (HMM E-Value=5.4e-32) 43 3e-04 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_12628| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_11213| Best HMM Match : RVT_1 (HMM E-Value=6.4e-38) 42 4e-04 SB_6740| Best HMM Match : RVT_1 (HMM E-Value=4.5e-22) 42 4e-04 SB_58198| Best HMM Match : Exo_endo_phos (HMM E-Value=0.012) 42 5e-04 SB_46946| Best HMM Match : RVT_1 (HMM E-Value=0.7) 42 5e-04 SB_8835| Best HMM Match : RVT_1 (HMM E-Value=1.2e-36) 42 5e-04 SB_29292| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_2591| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_799| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_58999| Best HMM Match : Exo_endo_phos (HMM E-Value=2.6) 41 9e-04 SB_54393| Best HMM Match : RNA_pol_Rpc34 (HMM E-Value=9.3e-10) 41 9e-04 SB_41382| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_3422| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_53252| Best HMM Match : RVT_1 (HMM E-Value=0) 41 0.001 SB_33763| Best HMM Match : RVT_1 (HMM E-Value=3.1e-17) 41 0.001 SB_11322| Best HMM Match : Pkinase_C (HMM E-Value=4.1) 41 0.001 SB_10854| Best HMM Match : Hormone_4 (HMM E-Value=8.4) 41 0.001 SB_39518| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0) 41 0.001 SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0) 41 0.001 SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_19684| Best HMM Match : RVT_1 (HMM E-Value=0) 41 0.001 SB_50861| Best HMM Match : Borrelia_orfA (HMM E-Value=4.4) 40 0.001 SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.001 SB_35755| Best HMM Match : RVT_1 (HMM E-Value=1.90001e-40) 40 0.001 SB_35248| Best HMM Match : DUF999 (HMM E-Value=2.7) 40 0.001 SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.001 SB_8718| Best HMM Match : Lipase_GDSL (HMM E-Value=0.023) 40 0.001 SB_47325| Best HMM Match : RVT_1 (HMM E-Value=2.2e-31) 40 0.001 SB_40728| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_27722| Best HMM Match : RVT_1 (HMM E-Value=0.00011) 40 0.001 SB_26566| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_22389| Best HMM Match : RVT_1 (HMM E-Value=1.6e-37) 40 0.001 SB_15883| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) 40 0.002 SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.002 SB_51085| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_42960| Best HMM Match : RVT_1 (HMM E-Value=2.38221e-44) 40 0.002 SB_38793| Best HMM Match : RepA_N (HMM E-Value=3.4) 40 0.002 SB_21083| Best HMM Match : PHD (HMM E-Value=5.3e-05) 40 0.002 SB_18991| Best HMM Match : RVT_1 (HMM E-Value=2.8e-34) 40 0.002 SB_11125| Best HMM Match : Borrelia_orfA (HMM E-Value=2.7) 40 0.002 SB_7753| Best HMM Match : RVT_1 (HMM E-Value=0.089) 40 0.002 SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.002 SB_3412| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.002 SB_48371| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_38334| Best HMM Match : RVT_1 (HMM E-Value=5.60519e-45) 40 0.002 SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14) 40 0.002 SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_9596| Best HMM Match : BAF (HMM E-Value=1.54143e-44) 40 0.002 SB_4888| Best HMM Match : DUF104 (HMM E-Value=7.3) 40 0.002 SB_50655| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) 40 0.003 SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_20167| Best HMM Match : RhoGEF (HMM E-Value=0.73) 40 0.003 SB_59519| Best HMM Match : RVT_1 (HMM E-Value=3.5e-11) 39 0.003 SB_48808| Best HMM Match : DEAD (HMM E-Value=0.029) 39 0.003 SB_5465| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38) 39 0.003 SB_41989| Best HMM Match : RVT_1 (HMM E-Value=1.2e-33) 39 0.003 SB_38851| Best HMM Match : RVT_1 (HMM E-Value=9.8e-20) 39 0.003 SB_32455| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_24072| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_54859| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.005 SB_48946| Best HMM Match : RVT_1 (HMM E-Value=1.49939e-43) 39 0.005 SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_40804| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_36393| Best HMM Match : IF2_N (HMM E-Value=5.1) 39 0.005 SB_34404| Best HMM Match : MtrG (HMM E-Value=6) 39 0.005 SB_27297| Best HMM Match : Bin3 (HMM E-Value=0.074) 39 0.005 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.005 SB_17727| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-12) 39 0.005 SB_15148| Best HMM Match : Exo_endo_phos (HMM E-Value=3.3e-15) 39 0.005 SB_10446| Best HMM Match : Exo_endo_phos (HMM E-Value=6.6e-20) 39 0.005 SB_1360| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.005 SB_41617| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.005 SB_34098| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.005 SB_29799| Best HMM Match : RVT_1 (HMM E-Value=3e-35) 39 0.005 SB_28157| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_25567| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.005 SB_13395| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_6031| Best HMM Match : RVT_1 (HMM E-Value=3.4) 39 0.005 SB_36459| Best HMM Match : FlgN (HMM E-Value=2.2) 38 0.006 SB_52970| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_45447| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_43156| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_36989| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_33535| Best HMM Match : RVT_1 (HMM E-Value=1.4013e-45) 38 0.008 SB_33113| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_19845| Best HMM Match : Macscav_rec (HMM E-Value=9.9) 38 0.008 SB_57527| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_55401| Best HMM Match : Flp_N (HMM E-Value=9.2) 38 0.008 SB_55395| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_32319| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_26022| Best HMM Match : DUF1235 (HMM E-Value=4.8) 38 0.008 SB_24630| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_16607| Best HMM Match : Flp_N (HMM E-Value=9.2) 38 0.008 SB_30907| Best HMM Match : THAP (HMM E-Value=0.0033) 38 0.011 SB_18309| Best HMM Match : Exo_endo_phos (HMM E-Value=2.3e-09) 38 0.011 SB_8258| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_39321| Best HMM Match : RVT_1 (HMM E-Value=4.5e-39) 37 0.014 SB_36813| Best HMM Match : RVT_1 (HMM E-Value=1.4e-14) 37 0.014 SB_17856| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.014 SB_55119| Best HMM Match : zf-HYPF (HMM E-Value=10) 37 0.018 SB_796| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_58114| Best HMM Match : DUF1478 (HMM E-Value=3) 37 0.018 SB_25560| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_5046| Best HMM Match : GST_N (HMM E-Value=2.5e-05) 36 0.024 SB_21205| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.75) 36 0.032 SB_19328| Best HMM Match : RVT_1 (HMM E-Value=2e-36) 36 0.032 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 36 0.032 SB_58944| Best HMM Match : fn3 (HMM E-Value=0.88) 36 0.032 SB_47673| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_45260| Best HMM Match : RVT_1 (HMM E-Value=1.2) 36 0.032 SB_27764| Best HMM Match : RVT_1 (HMM E-Value=3.99931e-42) 36 0.032 SB_57968| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_57595| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_48736| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) 36 0.043 SB_47354| Best HMM Match : RVT_1 (HMM E-Value=2e-07) 36 0.043 SB_46891| Best HMM Match : RVT_1 (HMM E-Value=1.6e-05) 36 0.043 SB_40928| Best HMM Match : MtrG (HMM E-Value=6) 36 0.043 SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29) 36 0.043 SB_4338| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_44548| Best HMM Match : MtrG (HMM E-Value=6) 36 0.043 SB_950| Best HMM Match : Flp_N (HMM E-Value=1.7) 36 0.043 SB_37654| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.074 SB_20278| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.074 SB_17390| Best HMM Match : Exo_endo_phos (HMM E-Value=3.1e-13) 35 0.074 SB_7615| Best HMM Match : RVT_1 (HMM E-Value=1e-33) 35 0.074 SB_45895| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 35 0.074 SB_31162| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.074 SB_18605| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.074 SB_44316| Best HMM Match : Exo_endo_phos (HMM E-Value=0.14) 34 0.098 SB_2424| Best HMM Match : RVT_1 (HMM E-Value=6.2e-18) 34 0.098 SB_32586| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.098 SB_26322| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.098 SB_21468| Best HMM Match : RVT_1 (HMM E-Value=1.2) 34 0.098 SB_20464| Best HMM Match : RVT_1 (HMM E-Value=0.016) 34 0.098 SB_53343| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) 34 0.13 SB_50373| Best HMM Match : HC2 (HMM E-Value=0.001) 34 0.13 SB_48543| Best HMM Match : Exo_endo_phos (HMM E-Value=7.8e-06) 34 0.13 SB_45778| Best HMM Match : Exo_endo_phos (HMM E-Value=1e-10) 34 0.13 SB_45315| Best HMM Match : DUF1235 (HMM E-Value=2.3) 34 0.13 SB_39766| Best HMM Match : RVT_1 (HMM E-Value=1.8e-07) 34 0.13 SB_29742| Best HMM Match : zf-CCHC (HMM E-Value=3.4e-05) 34 0.13 SB_29231| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_21418| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) 34 0.13 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 34 0.13 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_47528| Best HMM Match : RVT_1 (HMM E-Value=9.9e-16) 34 0.13 SB_45671| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_42168| Best HMM Match : NolV (HMM E-Value=7.1) 34 0.13 SB_36722| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_35582| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_31839| Best HMM Match : Exo_endo_phos (HMM E-Value=1.3e-11) 34 0.13 SB_16359| Best HMM Match : RVT_1 (HMM E-Value=0.00049) 34 0.13 SB_9990| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_9018| Best HMM Match : NolV (HMM E-Value=2.7) 34 0.13 SB_3024| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_2999| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) 34 0.13 SB_41296| Best HMM Match : RVT_1 (HMM E-Value=2.8e-24) 33 0.17 SB_36808| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_53389| Best HMM Match : Exo_endo_phos (HMM E-Value=6.3e-10) 33 0.23 SB_34166| Best HMM Match : RVT_1 (HMM E-Value=1e-23) 33 0.23 SB_28986| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_14815| Best HMM Match : RVT_1 (HMM E-Value=1.4) 33 0.23 SB_4872| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_4543| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_47504| Best HMM Match : RVT_1 (HMM E-Value=1.4e-07) 33 0.23 SB_22310| Best HMM Match : Exo_endo_phos (HMM E-Value=0.12) 33 0.23 SB_56872| Best HMM Match : RVT_1 (HMM E-Value=2.7e-30) 33 0.30 SB_54429| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_51839| Best HMM Match : Gp-FAR-1 (HMM E-Value=2) 33 0.30 SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 33 0.30 SB_48476| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 33 0.30 SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) 33 0.30 SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 33 0.30 SB_38578| Best HMM Match : RVT_1 (HMM E-Value=0.018) 33 0.30 SB_26855| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_25574| Best HMM Match : Gp-FAR-1 (HMM E-Value=1.9) 33 0.30 SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) 33 0.30 SB_7362| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 33 0.30 SB_452| Best HMM Match : RVT_1 (HMM E-Value=9.9e-25) 33 0.30 SB_56675| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-08) 33 0.30 SB_54423| Best HMM Match : RVT_1 (HMM E-Value=7.7e-32) 33 0.30 SB_54400| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_54374| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) 33 0.30 SB_51970| Best HMM Match : LacAB_rpiB (HMM E-Value=9.7) 33 0.30 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_43061| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_36757| Best HMM Match : RVT_1 (HMM E-Value=4.1e-28) 33 0.30 SB_20796| Best HMM Match : RVT_1 (HMM E-Value=0.047) 33 0.30 SB_12357| Best HMM Match : RVT_1 (HMM E-Value=7.69999e-41) 33 0.30 SB_3152| Best HMM Match : RVT_1 (HMM E-Value=5.4006e-42) 33 0.30 SB_3080| Best HMM Match : Methylase_S (HMM E-Value=2.6) 33 0.30 SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_31422| Best HMM Match : RVT_1 (HMM E-Value=1) 32 0.40 SB_25976| Best HMM Match : RVT_1 (HMM E-Value=5.3e-22) 32 0.40 SB_7771| Best HMM Match : RVT_1 (HMM E-Value=5.3e-13) 32 0.40 SB_6517| Best HMM Match : RVT_1 (HMM E-Value=2.3) 32 0.40 SB_1419| Best HMM Match : CSE2 (HMM E-Value=6.1) 32 0.40 SB_59736| Best HMM Match : RVT_1 (HMM E-Value=8.2e-31) 32 0.40 SB_57918| Best HMM Match : RVT_1 (HMM E-Value=1.1e-28) 32 0.40 SB_28146| Best HMM Match : Na_Ca_ex (HMM E-Value=0.039) 32 0.40 SB_25230| Best HMM Match : NACHT (HMM E-Value=0.0015) 32 0.40 SB_18334| Best HMM Match : CSE2 (HMM E-Value=4.9) 32 0.40 SB_18016| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_16993| Best HMM Match : RVT_1 (HMM E-Value=0.35) 32 0.40 SB_7284| Best HMM Match : F5_F8_type_C (HMM E-Value=7.3e-10) 32 0.40 SB_58109| Best HMM Match : Methylase_S (HMM E-Value=2.4) 32 0.52 SB_49526| Best HMM Match : HSBP1 (HMM E-Value=0.28) 32 0.52 SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) 32 0.52 SB_4188| Best HMM Match : 7tm_1 (HMM E-Value=9e-06) 32 0.52 SB_58227| Best HMM Match : HSBP1 (HMM E-Value=0.28) 32 0.52 SB_43536| Best HMM Match : DUF1410 (HMM E-Value=3.5) 32 0.52 SB_38463| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1e-17) 32 0.52 SB_37776| Best HMM Match : fn3 (HMM E-Value=1.4e-22) 32 0.52 SB_14635| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.52 SB_59615| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.69 SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) 31 0.69 SB_10928| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.69 SB_9994| Best HMM Match : SspO (HMM E-Value=0.39) 31 0.69 SB_58486| Best HMM Match : Vicilin_N (HMM E-Value=1.6) 31 0.69 SB_51811| Best HMM Match : Vicilin_N (HMM E-Value=1.9) 31 0.69 SB_42303| Best HMM Match : RVT_1 (HMM E-Value=0.00019) 31 0.69 SB_38417| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.69 SB_19398| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.69 SB_17431| Best HMM Match : RVT_1 (HMM E-Value=1.8e-25) 31 0.69 SB_8907| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.69 SB_10873| Best HMM Match : Exo_endo_phos (HMM E-Value=0.068) 31 0.92 SB_11314| Best HMM Match : LECT2 (HMM E-Value=8.3) 31 0.92 SB_38681| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 31 1.2 SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041) 31 1.2 SB_29242| Best HMM Match : CIDE-N (HMM E-Value=5) 31 1.2 SB_27103| Best HMM Match : Lipoprotein_3 (HMM E-Value=10) 31 1.2 SB_55514| Best HMM Match : RVT_1 (HMM E-Value=0.014) 31 1.2 SB_44847| Best HMM Match : RVT_1 (HMM E-Value=0.00042) 31 1.2 SB_23528| Best HMM Match : RVT_1 (HMM E-Value=0.00042) 31 1.2 SB_11042| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00013) 31 1.2 SB_46284| Best HMM Match : RVT_1 (HMM E-Value=0.48) 30 1.6 SB_17137| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_41460| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_40043| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_39222| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_31729| Best HMM Match : RVT_1 (HMM E-Value=0.023) 30 1.6 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) 30 2.1 SB_22943| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_18090| Best HMM Match : RVT_1 (HMM E-Value=0.59) 30 2.1 SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) 30 2.1 SB_59483| Best HMM Match : DUF402 (HMM E-Value=3.8) 30 2.1 SB_54746| Best HMM Match : RVT_1 (HMM E-Value=8.4e-11) 30 2.1 SB_50409| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_21388| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_17341| Best HMM Match : RVT_1 (HMM E-Value=0.063) 30 2.1 SB_14165| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_14103| Best HMM Match : RVT_1 (HMM E-Value=0.023) 30 2.1 SB_96| Best HMM Match : RVT_1 (HMM E-Value=0.00075) 29 2.8 SB_38561| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4) 29 2.8 SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_55618| Best HMM Match : RVT_1 (HMM E-Value=0.12) 29 3.7 SB_53870| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_50266| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_33430| Best HMM Match : RVT_1 (HMM E-Value=1.3e-26) 29 3.7 SB_31795| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_28387| Best HMM Match : RVT_1 (HMM E-Value=0.0013) 29 3.7 SB_33858| Best HMM Match : RVT_1 (HMM E-Value=3.7e-21) 29 3.7 SB_12879| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_5835| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_43399| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_8631| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_46731| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) 29 4.9 SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) 29 4.9 SB_37886| Best HMM Match : NGP1NT (HMM E-Value=1.2) 28 6.5 SB_13947| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_16275| Best HMM Match : RVT_1 (HMM E-Value=1.7e-16) 28 6.5 SB_12038| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 >SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2362 Score = 77.0 bits (181), Expect = 1e-14 Identities = 37/77 (48%), Positives = 50/77 (64%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 SNYRPIS+LPTLSKI E+ I +QL + SN LL +KQFGF +G ST A + + + Sbjct: 2149 SNYRPISILPTLSKILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSALSSFVDEVLL 2208 Query: 461 SWEESHDCLGIFCDLSK 511 + E+ C +F DL+K Sbjct: 2209 NMEQGKLCGAVFIDLTK 2225 Score = 32.3 bits (70), Expect = 0.40 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 L V L IS ++LK+ IA + ++ N I+ G FP L K SK+ L Sbjct: 2087 LKVNKAIGLDKISARLLKNSARTIAPSITNMLNLSIRSGKFPKLWKCSKITAL 2139 >SB_31876| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 630 Score = 77.0 bits (181), Expect = 1e-14 Identities = 37/77 (48%), Positives = 50/77 (64%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 SNYRPIS+LPTLSKI E+ I +QL + SN LL +KQFGF +G ST A + + + Sbjct: 278 SNYRPISILPTLSKILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSALSSFVDEVLL 337 Query: 461 SWEESHDCLGIFCDLSK 511 + E+ C +F DL+K Sbjct: 338 NMEQGKLCGAVFIDLTK 354 Score = 32.3 bits (70), Expect = 0.40 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 L V L IS ++LK+ IA + ++ N I+ G FP L K SK+ L Sbjct: 216 LKVNKAIGLDKISARLLKNSARTIAPSITNMLNLSIRSGKFPKLWKCSKITAL 268 >SB_38806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 77.0 bits (181), Expect = 1e-14 Identities = 37/77 (48%), Positives = 50/77 (64%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 SNYRPIS+LPTLSKI E+ I +QL + SN LL +KQFGF +G ST A + + + Sbjct: 112 SNYRPISILPTLSKILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSALSSFVDEVLL 171 Query: 461 SWEESHDCLGIFCDLSK 511 + E+ C +F DL+K Sbjct: 172 NMEQGKLCGAVFIDLTK 188 Score = 32.3 bits (70), Expect = 0.40 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 L V L IS ++LK+ IA + ++ N I+ G FP L K SK+ L Sbjct: 50 LKVNKAIGLDKISARLLKNSARTIAPSITNMLNLSIRSGKFPKLWKCSKITAL 102 >SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1182 Score = 77.0 bits (181), Expect = 1e-14 Identities = 37/77 (48%), Positives = 50/77 (64%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 SNYRPIS+LPTLSKI E+ I +QL + SN LL +KQFGF +G ST A + + + Sbjct: 410 SNYRPISILPTLSKILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSALSSFVDEVLL 469 Query: 461 SWEESHDCLGIFCDLSK 511 + E+ C +F DL+K Sbjct: 470 NMEQGKLCGAVFIDLTK 486 Score = 31.5 bits (68), Expect = 0.69 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 L V L IS ++LK+ IA + ++ N I+ G FP L K SK+ L Sbjct: 348 LKVNKAIGLDKISARLLKNSALTIAPSITNMLNLSIRSGKFPKLWKCSKITAL 400 >SB_10718| Best HMM Match : RVT_1 (HMM E-Value=2.3e-33) Length = 365 Score = 77.0 bits (181), Expect = 1e-14 Identities = 37/77 (48%), Positives = 50/77 (64%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 SNYRPIS+LPTLSKI E+ I +QL + SN LL +KQFGF +G ST A + + + Sbjct: 160 SNYRPISILPTLSKILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSALSSFVDEVLL 219 Query: 461 SWEESHDCLGIFCDLSK 511 + E+ C +F DL+K Sbjct: 220 NMEQGKLCGAVFIDLTK 236 Score = 32.3 bits (70), Expect = 0.40 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 L V L IS ++LK+ IA + ++ N I+ G FP L K SK+ L Sbjct: 98 LKVNKAIGLDKISARLLKNSARTIAPSITNMLNLSIRSGKFPKLWKCSKITAL 150 >SB_10470| Best HMM Match : Herpes_UL33 (HMM E-Value=1.8) Length = 170 Score = 70.5 bits (165), Expect = 1e-12 Identities = 33/82 (40%), Positives = 47/82 (57%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+LP SK++EK + QL+ + N+L+ Q+GF ST A ++ I Sbjct: 81 NYRPISILPCFSKLYEKAVYNQLISYINKCNILNINQYGFRHNHSTAMAVCDFVERITSV 140 Query: 464 WEESHDCLGIFCDLSKHLTVLN 529 ++ D +GIF DLSK LN Sbjct: 141 MDKGLDTIGIFLDLSKAFDTLN 162 Score = 45.6 bits (103), Expect = 4e-05 Identities = 21/53 (39%), Positives = 35/53 (66%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 L KN+ L GI +KV+K+ + I++S L ++ N + G+ PD +K +KVIP+ Sbjct: 18 LKNKNSYGLDGIDIKVVKASMSILSSPLSTLINKSLMTGIMPDQLKIAKVIPI 70 >SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34) Length = 875 Score = 70.1 bits (164), Expect = 2e-12 Identities = 34/84 (40%), Positives = 48/84 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRPIS+LP +SK+ EKI+ QL +HF +N +L +QFGF R ST A + + Sbjct: 194 PDNYRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWY 253 Query: 458 QSWEESHDCLGIFCDLSKHLTVLN 529 + + L +F DL K +N Sbjct: 254 INMDRQKFNLVVFLDLKKEFDTVN 277 Score = 70.1 bits (164), Expect = 2e-12 Identities = 34/84 (40%), Positives = 48/84 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRPIS+LP +SK+ EKI+ QL +HF +N +L +QFGF R ST A + + Sbjct: 483 PDNYRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWY 542 Query: 458 QSWEESHDCLGIFCDLSKHLTVLN 529 + + L +F DL K +N Sbjct: 543 INMDRQKFNLVVFLDLKKEFDTVN 566 Score = 34.7 bits (76), Expect = 0.074 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 IS K+LK I+ L IFN+ I FPD K ++V+PL Sbjct: 144 ISGKILKCAAHAISPSLTYIFNNSIISNCFPDEWKMARVLPL 185 Score = 34.7 bits (76), Expect = 0.074 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 IS K+LK I+ L IFN+ I FPD K ++V+PL Sbjct: 433 ISGKILKCAAHAISPSLTYIFNNSIISNCFPDEWKMARVLPL 474 >SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 623 Score = 69.3 bits (162), Expect = 3e-12 Identities = 34/84 (40%), Positives = 48/84 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRPIS+LP +SK+ EKI+ QL +HF +N +L +QFGF R ST A + + Sbjct: 194 PDNYRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWY 253 Query: 458 QSWEESHDCLGIFCDLSKHLTVLN 529 + + L +F DL K +N Sbjct: 254 INMDRQKFNLVVFLDLKKAFDTVN 277 Score = 34.7 bits (76), Expect = 0.074 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 IS K+LK I+ L IFN+ I FPD K ++V+PL Sbjct: 144 ISGKILKCAAHAISPSLTYIFNNSIISNCFPDEWKMARVLPL 185 >SB_26585| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 317 Score = 69.3 bits (162), Expect = 3e-12 Identities = 34/84 (40%), Positives = 48/84 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRPIS+LP +SK+ EKI+ QL +HF +N +L +QFGF R ST A + + Sbjct: 20 PDNYRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWY 79 Query: 458 QSWEESHDCLGIFCDLSKHLTVLN 529 + + L +F DL K +N Sbjct: 80 INMDRQKFNLVVFLDLKKAFDTVN 103 >SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 69.3 bits (162), Expect = 3e-12 Identities = 34/84 (40%), Positives = 48/84 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRPIS+LP +SK+ EKI+ QL +HF +N +L +QFGF R ST A + + Sbjct: 438 PDNYRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWY 497 Query: 458 QSWEESHDCLGIFCDLSKHLTVLN 529 + + L +F DL K +N Sbjct: 498 INMDRQKFNLVVFLDLKKAFDTVN 521 Score = 34.7 bits (76), Expect = 0.074 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 IS K+LK I+ L IFN+ I FPD K ++V+PL Sbjct: 388 ISGKILKCAAHAISPSLTYIFNNSIISNCFPDEWKMARVLPL 429 >SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 940 Score = 69.3 bits (162), Expect = 3e-12 Identities = 34/84 (40%), Positives = 48/84 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRPIS+LP +SK+ EKI+ QL +HF +N +L +QFGF R ST A + + Sbjct: 504 PDNYRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWY 563 Query: 458 QSWEESHDCLGIFCDLSKHLTVLN 529 + + L +F DL K +N Sbjct: 564 INMDRQKFNLVVFLDLKKAFDTVN 587 Score = 34.7 bits (76), Expect = 0.074 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 IS K+LK I+ L IFN+ I FPD K ++V+PL Sbjct: 454 ISGKILKCAAHAISPSLTYIFNNSIISNCFPDEWKMARVLPL 495 >SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1821 Score = 69.3 bits (162), Expect = 3e-12 Identities = 34/84 (40%), Positives = 48/84 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRPIS+LP +SK+ EKI+ QL +HF +N +L +QFGF R ST A + + Sbjct: 1385 PDNYRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWY 1444 Query: 458 QSWEESHDCLGIFCDLSKHLTVLN 529 + + L +F DL K +N Sbjct: 1445 INMDRQKFNLVVFLDLKKAFDTVN 1468 Score = 34.7 bits (76), Expect = 0.074 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 IS K+LK I+ L IFN+ I FPD K ++V+PL Sbjct: 1335 ISGKILKCAAHAISPSLTYIFNNSIISNCFPDEWKMARVLPL 1376 >SB_8605| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 284 Score = 69.3 bits (162), Expect = 3e-12 Identities = 34/84 (40%), Positives = 48/84 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRPIS+LP +SK+ EKI+ QL +HF +N +L +QFGF R ST A + + Sbjct: 20 PDNYRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWY 79 Query: 458 QSWEESHDCLGIFCDLSKHLTVLN 529 + + L +F DL K +N Sbjct: 80 INMDRQKFNLVVFLDLKKAFDTVN 103 >SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 69.3 bits (162), Expect = 3e-12 Identities = 34/84 (40%), Positives = 48/84 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRPIS+LP +SK+ EKI+ QL +HF +N +L +QFGF R ST A + + Sbjct: 701 PDNYRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWY 760 Query: 458 QSWEESHDCLGIFCDLSKHLTVLN 529 + + L +F DL K +N Sbjct: 761 INMDRQKFNLVVFLDLKKAFDTVN 784 Score = 34.7 bits (76), Expect = 0.074 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 IS K+LK I+ L IFN+ I FPD K ++V+PL Sbjct: 651 ISGKILKCAAHAISPSLTYIFNNSIISNCFPDEWKMARVLPL 692 >SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 680 Score = 69.3 bits (162), Expect = 3e-12 Identities = 34/84 (40%), Positives = 48/84 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRPIS+LP +SK+ EKI+ QL +HF +N +L +QFGF R ST A + + Sbjct: 244 PDNYRPISILPVISKLMEKIMYEQLYDHFTANQILSEQQFGFRRLHSTVSALLDSTNSWY 303 Query: 458 QSWEESHDCLGIFCDLSKHLTVLN 529 + + L +F DL K +N Sbjct: 304 INMDRQKFNLVVFLDLKKAFDTVN 327 Score = 34.7 bits (76), Expect = 0.074 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 IS K+LK I+ L IFN+ I FPD K ++V+PL Sbjct: 194 ISGKILKCAAHAISPSLTYIFNNSIISNCFPDEWKMARVLPL 235 >SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 68.1 bits (159), Expect = 7e-12 Identities = 40/123 (32%), Positives = 65/123 (52%), Gaps = 1/123 (0%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 SNYRPIS+LP ++IFEK+I +L + +++N+LH+ FGF STT A ++ I + Sbjct: 88 SNYRPISLLPIFNQIFEKLICQRLNHYLQTHNILHSNHFGFRPKHSTTHAVLSVVDKIQK 147 Query: 461 SWEESHDCLGIFCDLSKHLTVLNMKHGEETTSLWD*GWVHWNLLPSYLF-RKGYQPVGCG 637 + E G+F DLSK ++ + + ++ SYL RK + +G Sbjct: 148 AIELGQFSCGLFLDLSKAFDTVDHSILLRKLEHYGIRGIAYDWFSSYLTNRKQFTQIGSS 207 Query: 638 KGN 646 K + Sbjct: 208 KSS 210 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/53 (35%), Positives = 30/53 (56%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LN + + I +VLKS I++ L ++N I+ G+ PD K +KVIP+ Sbjct: 26 LNSNKSTGPFSIPTRVLKSASSILSKPLAMLYNFSIESGIVPDKFKIAKVIPV 78 >SB_27420| Best HMM Match : PHB_acc (HMM E-Value=6.6) Length = 291 Score = 67.7 bits (158), Expect = 9e-12 Identities = 30/78 (38%), Positives = 48/78 (61%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P+NYRPIS+L L++I+EK++ T+++ + N LL+ Q+GF + ST A +I I Sbjct: 201 PNNYRPISLLSNLNRIYEKLVYTKMVSFIEDNGLLYKAQYGFRKSHSTQHATLDIINTIH 260 Query: 458 QSWEESHDCLGIFCDLSK 511 ++ + GIF DL K Sbjct: 261 RNMDNRFYSCGIFLDLKK 278 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = +3 Query: 120 LWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 L+ +++LK V II+ L + N + G +PD +K SK+ P+ Sbjct: 148 LYSCPIQLLKCVSHIISHPLALLLNMSVAQGTYPDKLKMSKIAPV 192 >SB_14797| Best HMM Match : RVT_1 (HMM E-Value=7.9e-33) Length = 252 Score = 67.7 bits (158), Expect = 9e-12 Identities = 40/123 (32%), Positives = 66/123 (53%), Gaps = 1/123 (0%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 SNYRPIS+LP ++IFEK+I +L + +++N+L++ QFGF STT A ++ I + Sbjct: 34 SNYRPISLLPIFNQIFEKLICQRLNHYLQTHNILYSNQFGFRPKHSTTHAVLSVVDKIQK 93 Query: 461 SWEESHDCLGIFCDLSKHLTVLNMKHGEETTSLWD*GWVHWNLLPSYLF-RKGYQPVGCG 637 + E G+F DLSK ++ + + ++ SYL RK + +G Sbjct: 94 AIELGQFSCGLFLDLSKAFDTVDHSILLRKLEHYGIRGIAYDWFSSYLTNRKQFTQIGSS 153 Query: 638 KGN 646 K + Sbjct: 154 KSS 156 >SB_11851| Best HMM Match : IncFII_repA (HMM E-Value=1.4) Length = 401 Score = 67.7 bits (158), Expect = 9e-12 Identities = 40/123 (32%), Positives = 66/123 (53%), Gaps = 1/123 (0%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 SNYRPIS+LP ++IFEK+I +L + +++N+L++ QFGF STT A ++ I + Sbjct: 245 SNYRPISLLPIFNQIFEKLICQRLNHYLQTHNILYSNQFGFRPKHSTTHAVLSVVDKIQK 304 Query: 461 SWEESHDCLGIFCDLSKHLTVLNMKHGEETTSLWD*GWVHWNLLPSYLF-RKGYQPVGCG 637 + E G+F DLSK ++ + + ++ SYL RK + +G Sbjct: 305 AIELGQFSCGLFLDLSKAFDTVDHSILLRKLEHYGIRGIAYDWFSSYLTNRKQFTQIGSS 364 Query: 638 KGN 646 K + Sbjct: 365 KSS 367 Score = 36.3 bits (80), Expect = 0.024 Identities = 18/53 (33%), Positives = 29/53 (54%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LN + + I +VLKS I++ L ++ I+ G+ PD K +KVIP+ Sbjct: 183 LNSNKSTGPFSIPTRVLKSASSILSKPLAMLYYFSIESGIVPDKFKIAKVIPV 235 >SB_8080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 273 Score = 67.7 bits (158), Expect = 9e-12 Identities = 40/123 (32%), Positives = 66/123 (53%), Gaps = 1/123 (0%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 SNYRPIS+LP ++IFEK+I +L + +++N+L++ QFGF STT A ++ I + Sbjct: 34 SNYRPISLLPIFNQIFEKLICQRLNHYLQTHNILYSNQFGFRPKHSTTHAVLSVVDKIQK 93 Query: 461 SWEESHDCLGIFCDLSKHLTVLNMKHGEETTSLWD*GWVHWNLLPSYLF-RKGYQPVGCG 637 + E G+F DLSK ++ + + ++ SYL RK + +G Sbjct: 94 AIELGQFSCGLFLDLSKAFDTVDHSILLRKLEHYGIRGIAYDWFSSYLTNRKQFTQIGSS 153 Query: 638 KGN 646 K + Sbjct: 154 KSS 156 >SB_11746| Best HMM Match : RVT_1 (HMM E-Value=5e-31) Length = 323 Score = 66.9 bits (156), Expect = 2e-11 Identities = 30/78 (38%), Positives = 48/78 (61%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P+NYRPIS+L L++I+EK++ T+++ + N LL+ Q+GF + ST A +I I Sbjct: 16 PNNYRPISLLSNLNRIYEKLVYTKMVSFIEDNGLLYKAQYGFRKSHSTQHATLDIINTIQ 75 Query: 458 QSWEESHDCLGIFCDLSK 511 ++ + GIF DL K Sbjct: 76 RNMDNRFYSCGIFLDLKK 93 >SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1855 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/88 (38%), Positives = 49/88 (55%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRPIS++P +SK+ E I+ QL +H NN+L + QFGF + STT A + + Sbjct: 534 PDNYRPISIMPVISKLMENIMFEQLYDHLIKNNILSDHQFGFRKLHSTTSALLDCTNSWY 593 Query: 458 QSWEESHDCLGIFCDLSKHLTVLNMKHG 541 + + L +F DL K +N HG Sbjct: 594 VNMDRKLFNLVVFLDLKKAFDTVN--HG 619 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/49 (36%), Positives = 29/49 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTT 424 P NYRP+S+ + K+ E I+ QL H ++++ + Q GF +G S T Sbjct: 1556 PKNYRPVSLTSLVCKVMEHIVCKQLTSHLSEHSIISHHQHGFQKGLSCT 1604 >SB_6009| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 895 Score = 65.3 bits (152), Expect = 5e-11 Identities = 33/87 (37%), Positives = 48/87 (55%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +NYRP+SVLP SK FEK++ +L ++L N Q+GF + ST A +L + Sbjct: 771 ANYRPVSVLPVFSKFFEKVVYKRLYNFLVKYDILSNNQYGFRKNHSTALALLHLYDTLSS 830 Query: 461 SWEESHDCLGIFCDLSKHLTVLNMKHG 541 + + LG+F DLSK +N HG Sbjct: 831 AIDYKKYTLGVFIDLSKAFDTVN--HG 855 Score = 31.9 bits (69), Expect = 0.52 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 I + ++K IDII+ + I N + G+ P +K ++V+PL Sbjct: 720 IHMDIIKPNIDIISKPIADIINLSTRSGIVPKKLKVARVLPL 761 >SB_34368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 64.9 bits (151), Expect = 6e-11 Identities = 33/87 (37%), Positives = 48/87 (55%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +NYRP+SVLP SK FEK++ +L ++L N Q+GF + ST A +L + Sbjct: 281 ANYRPVSVLPVFSKFFEKVVYKRLYNFLIKYDILSNNQYGFRKNHSTVLALLHLYDTLSS 340 Query: 461 SWEESHDCLGIFCDLSKHLTVLNMKHG 541 + + LG+F DLSK +N HG Sbjct: 341 AIDYKKYTLGVFIDLSKAFDTVN--HG 365 Score = 31.1 bits (67), Expect = 0.92 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 I + ++K IDII+ + I N + G+ P +K + V+PL Sbjct: 230 IHIDIIKPNIDIISKPIADIINLSTRSGIVPKKLKVAGVLPL 271 >SB_7972| Best HMM Match : RVT_1 (HMM E-Value=5.8e-29) Length = 382 Score = 64.1 bits (149), Expect = 1e-10 Identities = 32/77 (41%), Positives = 49/77 (63%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 SNYR IS+LP ++IFEK+I +L + +++N+L++ QFGF STT A ++ I + Sbjct: 168 SNYRSISLLPIFNQIFEKLICQRLNHYLQTHNILYSNQFGFRPKHSTTHAVLSVVDKIQK 227 Query: 461 SWEESHDCLGIFCDLSK 511 + E G+F DLSK Sbjct: 228 AIELGQFSCGLFLDLSK 244 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/53 (35%), Positives = 30/53 (56%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LN + + I +VLKS I++ L ++N I+ G+ PD K +KVIP+ Sbjct: 106 LNSNKSTGPFSIPTRVLKSASSILSKPLAMLYNFSIESGIVPDKFKIAKVIPV 158 >SB_38467| Best HMM Match : RVT_1 (HMM E-Value=4.2e-05) Length = 400 Score = 63.7 bits (148), Expect = 1e-10 Identities = 41/124 (33%), Positives = 67/124 (54%), Gaps = 3/124 (2%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+LP ++IFEK+I +L + +++N+L++ QFGF STT A ++ I ++ Sbjct: 174 NYRPISLLPIFNQIFEKLICQRLNHYLQTHNILYSNQFGFRPKHSTTHAVLSVVDKIQKA 233 Query: 464 WEESHDCLGIFCDLSKHLTVLNMKHGEETTSLWD*GW--VHWNLLPSYLF-RKGYQPVGC 634 E G+F D SK ++ H L G+ + ++ SYL RK + +G Sbjct: 234 IELGQYSCGLFLDPSKAFDTVD--HSILLRKLEHYGFRGIAYDWFSSYLTNRKQFTQIGS 291 Query: 635 GKGN 646 K + Sbjct: 292 SKSS 295 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/53 (33%), Positives = 30/53 (56%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LN + + I ++LKS I++ L ++N I+ G+ PD K +KVIP+ Sbjct: 111 LNSNKSTGPFSIPTRILKSASSILSKPLAMLYNFSIESGIVPDKFKIAKVIPV 163 >SB_43683| Best HMM Match : RVT_1 (HMM E-Value=0.024) Length = 474 Score = 63.3 bits (147), Expect = 2e-10 Identities = 34/87 (39%), Positives = 48/87 (55%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +NYRP+SVLP SKIFEK++ +L ++L KQ+GF + ST A +L + Sbjct: 90 ANYRPVSVLPVFSKIFEKVVYKRLYNFLIKYDILSKKQYGFRKNHSTALALLHLYDTLSN 149 Query: 461 SWEESHDCLGIFCDLSKHLTVLNMKHG 541 + + LG F DLSK +N HG Sbjct: 150 AIDYKKYTLGGFIDLSKAFDTVN--HG 174 Score = 31.9 bits (69), Expect = 0.52 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 I + ++K IDII+ + I N + G+ P +K ++V+PL Sbjct: 39 IHMDIIKPNIDIISKPIADIINLSTRSGIVPKKLKVARVLPL 80 >SB_9604| Best HMM Match : Cbl_N3 (HMM E-Value=1.2) Length = 317 Score = 63.3 bits (147), Expect = 2e-10 Identities = 32/82 (39%), Positives = 46/82 (56%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRP+SVLP SK EKI+ +L + NLL + Q+GF + ST A +L + + Sbjct: 176 NYRPVSVLPIFSKFLEKIMYDRLYKFLIKYNLLFDNQYGFKKHHSTALALIHLYDKLSSA 235 Query: 464 WEESHDCLGIFCDLSKHLTVLN 529 + +G+F DLSK V+N Sbjct: 236 IDNKEFTMGVFIDLSKAFDVVN 257 Score = 35.9 bits (79), Expect = 0.032 Identities = 17/42 (40%), Positives = 27/42 (64%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 I + V+K++ID+I + +I N I GV P +K ++VIPL Sbjct: 124 IHMDVVKNIIDLILKPIANIINLSISLGVVPKELKIARVIPL 165 >SB_3992| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 354 Score = 63.3 bits (147), Expect = 2e-10 Identities = 31/84 (36%), Positives = 46/84 (54%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRPIS++ + SKI EK+I QL+ + + +L QFGF +G ST A ++ + Sbjct: 199 PGNYRPISIICSFSKILEKLIYNQLIFFLEKHKILFEFQFGFRKGHSTEHAILETVETLK 258 Query: 458 QSWEESHDCLGIFCDLSKHLTVLN 529 S ++ IF D SK +N Sbjct: 259 SSIDQGMTTCAIFLDFSKAFDTIN 282 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 138 KVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 K +K I+AS +I+N+ I G PD+ K S+V P+ Sbjct: 152 KFIKLSASILASPFTAIYNESIASGEVPDIFKISRVTPI 190 >SB_4171| Best HMM Match : Cbl_N3 (HMM E-Value=1.2) Length = 243 Score = 63.3 bits (147), Expect = 2e-10 Identities = 32/82 (39%), Positives = 46/82 (56%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRP+SVLP SK EKI+ +L + NLL + Q+GF + ST A +L + + Sbjct: 102 NYRPVSVLPIFSKFLEKIMYDRLYKFLIKYNLLFDNQYGFKKHHSTALALIHLYDKLSSA 161 Query: 464 WEESHDCLGIFCDLSKHLTVLN 529 + +G+F DLSK V+N Sbjct: 162 IDNKEFTMGVFIDLSKAFDVVN 183 Score = 35.9 bits (79), Expect = 0.032 Identities = 17/42 (40%), Positives = 27/42 (64%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 I + V+K++ID+I + +I N I GV P +K ++VIPL Sbjct: 50 IHMDVVKNIIDLILKPIANIINLSISLGVVPKELKIARVIPL 91 >SB_39089| Best HMM Match : RVT_1 (HMM E-Value=2.2e-20) Length = 396 Score = 62.1 bits (144), Expect = 4e-10 Identities = 31/84 (36%), Positives = 47/84 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +KI EK++ +L+ N+L++KQFGF +T A ++ I ++ Sbjct: 3 NYRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREQHTTFHATLLIVDKIQRA 62 Query: 464 WEESHDCLGIFCDLSKHLTVLNMK 535 EE GIF D SK ++ K Sbjct: 63 IEEGQYSCGIFLDFSKAFDTVDHK 86 >SB_38898| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) Length = 234 Score = 62.1 bits (144), Expect = 4e-10 Identities = 31/84 (36%), Positives = 47/84 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +KI EK++ +L+ N+L++KQFGF +T A ++ I ++ Sbjct: 3 NYRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRA 62 Query: 464 WEESHDCLGIFCDLSKHLTVLNMK 535 EE GIF D SK ++ K Sbjct: 63 IEEGQYSCGIFLDFSKAFDTVDHK 86 >SB_32540| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) Length = 234 Score = 62.1 bits (144), Expect = 4e-10 Identities = 31/84 (36%), Positives = 47/84 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +KI EK++ +L+ N+L++KQFGF +T A ++ I ++ Sbjct: 3 NYRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRA 62 Query: 464 WEESHDCLGIFCDLSKHLTVLNMK 535 EE GIF D SK ++ K Sbjct: 63 IEEGQYSCGIFLDFSKAFDTVDHK 86 >SB_22988| Best HMM Match : RVT_1 (HMM E-Value=5.70328e-43) Length = 1029 Score = 62.1 bits (144), Expect = 4e-10 Identities = 31/84 (36%), Positives = 47/84 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +KI EK++ +L+ N+L++KQFGF +T A ++ I ++ Sbjct: 717 NYRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREQHTTFHATLLIVDKIQRA 776 Query: 464 WEESHDCLGIFCDLSKHLTVLNMK 535 EE GIF D SK ++ K Sbjct: 777 IEEGQYSCGIFLDFSKAFDTVDHK 800 >SB_21614| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-41) Length = 1047 Score = 62.1 bits (144), Expect = 4e-10 Identities = 31/84 (36%), Positives = 47/84 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +KI EK++ +L+ N+L++KQFGF +T A ++ I ++ Sbjct: 816 NYRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRA 875 Query: 464 WEESHDCLGIFCDLSKHLTVLNMK 535 EE GIF D SK ++ K Sbjct: 876 IEEGQYSCGIFLDFSKAFDTVDHK 899 >SB_1476| Best HMM Match : RVT_1 (HMM E-Value=5.49309e-43) Length = 1078 Score = 62.1 bits (144), Expect = 4e-10 Identities = 31/84 (36%), Positives = 47/84 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +KI EK++ +L+ N+L++KQFGF +T A ++ I ++ Sbjct: 470 NYRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRA 529 Query: 464 WEESHDCLGIFCDLSKHLTVLNMK 535 EE GIF D SK ++ K Sbjct: 530 IEEGQYSCGIFLDFSKAFDTVDHK 553 >SB_57427| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00044) Length = 1693 Score = 62.1 bits (144), Expect = 4e-10 Identities = 31/84 (36%), Positives = 47/84 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +KI EK++ +L+ N+L++KQFGF +T A ++ I ++ Sbjct: 1595 NYRPISLLSMFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRA 1654 Query: 464 WEESHDCLGIFCDLSKHLTVLNMK 535 EE GIF D SK ++ K Sbjct: 1655 IEEGQYSCGIFLDFSKAFDTVDHK 1678 >SB_48325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 872 Score = 62.1 bits (144), Expect = 4e-10 Identities = 31/84 (36%), Positives = 47/84 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +KI EK++ +L+ N+L++KQFGF +T A ++ I ++ Sbjct: 666 NYRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRA 725 Query: 464 WEESHDCLGIFCDLSKHLTVLNMK 535 EE GIF D SK ++ K Sbjct: 726 IEEGQYSCGIFLDFSKAFDTVDHK 749 >SB_34884| Best HMM Match : RVT_1 (HMM E-Value=8.1e-25) Length = 439 Score = 62.1 bits (144), Expect = 4e-10 Identities = 31/84 (36%), Positives = 47/84 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +KI EK++ +L+ N+L++KQFGF +T A ++ I ++ Sbjct: 3 NYRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRA 62 Query: 464 WEESHDCLGIFCDLSKHLTVLNMK 535 EE GIF D SK ++ K Sbjct: 63 IEEGQYSCGIFLDFSKAFDTVDHK 86 >SB_33122| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) Length = 234 Score = 62.1 bits (144), Expect = 4e-10 Identities = 31/84 (36%), Positives = 47/84 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +KI EK++ +L+ N+L++KQFGF +T A ++ I ++ Sbjct: 3 NYRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRA 62 Query: 464 WEESHDCLGIFCDLSKHLTVLNMK 535 EE GIF D SK ++ K Sbjct: 63 IEEGQYSCGIFLDFSKAFDTVDHK 86 >SB_23765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 62.1 bits (144), Expect = 4e-10 Identities = 31/84 (36%), Positives = 47/84 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +KI EK++ +L+ N+L++KQFGF +T A ++ I ++ Sbjct: 3 NYRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREQHTTFHATLLIVDKIQRA 62 Query: 464 WEESHDCLGIFCDLSKHLTVLNMK 535 EE GIF D SK ++ K Sbjct: 63 IEEGQYSCGIFLDFSKAFDTVDHK 86 >SB_14369| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) Length = 234 Score = 62.1 bits (144), Expect = 4e-10 Identities = 31/84 (36%), Positives = 47/84 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +KI EK++ +L+ N+L++KQFGF +T A ++ I ++ Sbjct: 3 NYRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRA 62 Query: 464 WEESHDCLGIFCDLSKHLTVLNMK 535 EE GIF D SK ++ K Sbjct: 63 IEEGQYSCGIFLDFSKAFDTVDHK 86 >SB_10116| Best HMM Match : RVT_1 (HMM E-Value=2.5e-33) Length = 759 Score = 62.1 bits (144), Expect = 4e-10 Identities = 31/84 (36%), Positives = 47/84 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +KI EK++ +L+ N+L++KQFGF +T A ++ I ++ Sbjct: 542 NYRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRA 601 Query: 464 WEESHDCLGIFCDLSKHLTVLNMK 535 EE GIF D SK ++ K Sbjct: 602 IEEGQYSCGIFLDFSKAFDTVDHK 625 >SB_4524| Best HMM Match : Ribosomal_S7e (HMM E-Value=0.59) Length = 367 Score = 62.1 bits (144), Expect = 4e-10 Identities = 31/84 (36%), Positives = 47/84 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +KI EK++ +L+ N+L++KQFGF +T A ++ I ++ Sbjct: 235 NYRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREQHTTFHATLLIVDKIQRA 294 Query: 464 WEESHDCLGIFCDLSKHLTVLNMK 535 EE GIF D SK ++ K Sbjct: 295 IEEGQYSCGIFLDFSKAFDTVDHK 318 >SB_3348| Best HMM Match : Borrelia_orfA (HMM E-Value=0.71) Length = 500 Score = 62.1 bits (144), Expect = 4e-10 Identities = 31/84 (36%), Positives = 47/84 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +KI EK++ +L+ N+L++KQFGF +T A ++ I ++ Sbjct: 368 NYRPISLLSIFNKILEKLMYKRLIAFINKYNILYDKQFGFREQHTTFHATLLIVDKIQRA 427 Query: 464 WEESHDCLGIFCDLSKHLTVLNMK 535 EE GIF D SK ++ K Sbjct: 428 IEEGQYSCGIFLDFSKAFDTVDHK 451 >SB_41511| Best HMM Match : SAP (HMM E-Value=2.7e-08) Length = 993 Score = 61.3 bits (142), Expect = 7e-10 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDA 430 P NYRPIS+LP +SK+ E I+ QL +H NN+L QFGF + STT A Sbjct: 882 PDNYRPISILPVISKLMENIMFEQLYDHLIKNNILSEHQFGFRKLHSTTYA 932 Score = 32.3 bits (70), Expect = 0.40 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = +3 Query: 132 SVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 S K+LK+ I+ L IFN+ I FPD K ++V+PL Sbjct: 833 SGKILKAAASSISPSLSYIFNNAIITCCFPDEWKMARVLPL 873 >SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1868 Score = 61.3 bits (142), Expect = 7e-10 Identities = 29/88 (32%), Positives = 51/88 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P N+RPIS L T +++ EK++ Q++ + + N+L+ Q GF +G ST+ A +I + Sbjct: 1389 PFNFRPISTLSTFTQVLEKLVYQQIINYVEKQNILYECQLGFRKGYSTSLAITEIINTLR 1448 Query: 458 QSWEESHDCLGIFCDLSKHLTVLNMKHG 541 ++ + + G+F D SK +N HG Sbjct: 1449 KAIDNNMYTCGVFLDFSKAFDTVN--HG 1474 Score = 32.7 bits (71), Expect = 0.30 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +3 Query: 126 GISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 G+ + +K I+ L +I N ++ GV PD++K SK+ P+ Sbjct: 1338 GVPRRCIKLASSHISDSLTTILNQLLQQGVVPDILKISKITPV 1380 >SB_25914| Best HMM Match : IL1_propep (HMM E-Value=8.1) Length = 131 Score = 61.3 bits (142), Expect = 7e-10 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDA 430 P NYRPIS+LP +SK+ E I+ QL +H NN+L QFGF + STT A Sbjct: 20 PDNYRPISILPVISKLMENIMFEQLYDHLIKNNILSEHQFGFRKLHSTTYA 70 >SB_8360| Best HMM Match : RVT_1 (HMM E-Value=3.6e-07) Length = 468 Score = 61.3 bits (142), Expect = 7e-10 Identities = 31/84 (36%), Positives = 46/84 (54%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +KI EK+ +L+ N+L++KQFGF +T A ++ I ++ Sbjct: 272 NYRPISLLSIFNKILEKLTYKRLIAFINKYNILYDKQFGFREHHTTFHATLLIVDKIQRA 331 Query: 464 WEESHDCLGIFCDLSKHLTVLNMK 535 EE GIF D SK ++ K Sbjct: 332 IEEGQYSCGIFLDFSKAFDTVDHK 355 Score = 27.9 bits (59), Expect = 8.5 Identities = 15/53 (28%), Positives = 26/53 (49%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LN + + I V +LK + ++ L ++N G PD +K +K IP+ Sbjct: 209 LNPSKASGPYSIPVCLLKFLKSYLSVPLEILYNHSFSNGCVPDQLKIAKTIPI 261 >SB_34832| Best HMM Match : SAP (HMM E-Value=1.4e-07) Length = 1054 Score = 60.9 bits (141), Expect = 1e-09 Identities = 27/51 (52%), Positives = 35/51 (68%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDA 430 P NYRPIS+LP +SKI E+I+ QL ++ N+L+ N QFGF R ST A Sbjct: 703 PENYRPISILPVISKIMERILSNQLYKYLLKNSLISNHQFGFRRLHSTMSA 753 Score = 35.5 bits (78), Expect = 0.043 Identities = 20/43 (46%), Positives = 26/43 (60%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPLL 257 +S K+LK+ IA L IFN IK FP+ K ++VIPLL Sbjct: 653 VSGKMLKAAAPAIAQSLSYIFNSSIKTCHFPNDWKIARVIPLL 695 >SB_15184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 60.5 bits (140), Expect = 1e-09 Identities = 29/88 (32%), Positives = 51/88 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P N+RPIS L T +++ EK++ Q++ + + N+L+ QF F +G ST+ A +I + Sbjct: 103 PFNFRPISTLSTFTQVLEKLVYQQIINYVEKQNILYECQFQFRKGYSTSLAITEIINTLR 162 Query: 458 QSWEESHDCLGIFCDLSKHLTVLNMKHG 541 ++ + + G+F D SK +N HG Sbjct: 163 KAIDNNMYTCGVFLDFSKAFDTVN--HG 188 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +3 Query: 126 GISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 G+ + +K I+ L +I N ++ GV PD++K SK+ P+ Sbjct: 52 GVPRRCIKPASSHISDSLTTILNQSLQQGVVPDILKISKITPV 94 >SB_17488| Best HMM Match : Phi-29_GP3 (HMM E-Value=0.69) Length = 250 Score = 60.5 bits (140), Expect = 1e-09 Identities = 29/88 (32%), Positives = 51/88 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P N+RPIS L T +++ EK++ Q++ + + N+L+ QF F +G ST+ A +I + Sbjct: 145 PFNFRPISTLSTFTQVLEKLVYQQIINYVEKQNILYECQFQFRKGYSTSLAITEIINTLR 204 Query: 458 QSWEESHDCLGIFCDLSKHLTVLNMKHG 541 ++ + + G+F D SK +N HG Sbjct: 205 KAIDNNMYTCGVFLDFSKAFDTVN--HG 230 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +3 Query: 126 GISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 G+ + +K I+ L +I N ++ GV PD++K SK+ P+ Sbjct: 94 GVPRRCIKPASSHISDSLTTILNQSLQQGVVPDILKISKITPV 136 >SB_30213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 60.1 bits (139), Expect = 2e-09 Identities = 30/84 (35%), Positives = 47/84 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +K +EK++ +L+ N+L++KQFGF +T A ++ I ++ Sbjct: 3 NYRPISLLSIFNKSWEKLMYKRLIAFINKYNILYDKQFGFREQHTTFHATLLIVDKIQRA 62 Query: 464 WEESHDCLGIFCDLSKHLTVLNMK 535 EE GIF D SK ++ K Sbjct: 63 IEEGQYSCGIFLDFSKAFDTVDHK 86 >SB_49613| Best HMM Match : Transposase_5 (HMM E-Value=0.033) Length = 999 Score = 58.8 bits (136), Expect = 4e-09 Identities = 25/51 (49%), Positives = 35/51 (68%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDA 430 P NYRPIS+LP +SK+ E I+ QL ++ NN+L + +FGF + STT A Sbjct: 16 PDNYRPISILPVISKLMENIMFEQLYDYLIKNNILSDHRFGFRKLHSTTSA 66 >SB_18971| Best HMM Match : PWP2 (HMM E-Value=4) Length = 400 Score = 58.8 bits (136), Expect = 4e-09 Identities = 28/84 (33%), Positives = 49/84 (58%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRPIS L +++FEK++ QL+ + + + +L+ QFGF + S+ A A + N+ Sbjct: 308 PFNYRPISTLS--AQVFEKLVCKQLVAYLEKHQILYEFQFGFRKNHSSAQAIAEIADNLR 365 Query: 458 QSWEESHDCLGIFCDLSKHLTVLN 529 ++ + + G+F D SK +N Sbjct: 366 KAIDNNQYTCGVFLDFSKAFDTVN 389 >SB_10046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 56.0 bits (129), Expect = 3e-08 Identities = 26/84 (30%), Positives = 47/84 (55%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P N+RPIS T +++ EK++ Q++ + N+L+ QF F +G ST+ A +I + Sbjct: 42 PFNFRPISTPSTFTQVLEKLVYQQIINYVGKQNILYKCQFRFRKGYSTSLAITEIINTLR 101 Query: 458 QSWEESHDCLGIFCDLSKHLTVLN 529 ++ + + G+F D SK +N Sbjct: 102 KAIDNNMYTCGVFLDFSKAFDTVN 125 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 165 IASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 I+ L +I N ++ GV PD++K SK+ P+ Sbjct: 4 ISDSLTTILNQSLQQGVVPDILKISKITPV 33 >SB_13949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 867 Score = 54.8 bits (126), Expect = 6e-08 Identities = 26/63 (41%), Positives = 42/63 (66%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 SNYRPIS+ P ++IFEK+I +L + +++N+L++ QFGF STT A ++ I + Sbjct: 341 SNYRPISLPPIFNQIFEKLICQRLNHYLQTHNILYSNQFGFRPKHSTTHAVLSVVDKIQK 400 Query: 461 SWE 469 + E Sbjct: 401 AIE 403 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/53 (35%), Positives = 30/53 (56%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LN + + I +VLKS I++ L ++N I+ G+ PD K +KVIP+ Sbjct: 279 LNSNKSTGPFSIPTRVLKSAGSILSKPLAMLYNFSIESGIVPDKFKIAKVIPV 331 >SB_13020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 722 Score = 54.8 bits (126), Expect = 6e-08 Identities = 38/121 (31%), Positives = 58/121 (47%), Gaps = 5/121 (4%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRPIS++ + SKI EK+I QL+ + + +L QFGF +G ST A ++ + Sbjct: 413 PGNYRPISIICSFSKILEKLIYNQLIFFLEKHKILFEFQFGFRKGHSTEHAILETVETLK 472 Query: 458 QSWEESHDCLGIFCD-----LSKHLTVLNMKHGEETTSLWD*GWVHWNLLPSYLFRKGYQ 622 S ++ I D +S ++ V+ K W WV LL +Y G+ Sbjct: 473 SSIDQDQKVRRIPADRGCPVVSSYVFVIKRK--------WSAKWVRAALL-NYFVNMGFC 523 Query: 623 P 625 P Sbjct: 524 P 524 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 138 KVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 K +K I+AS +I+N+ I G PD+ K S+V P+ Sbjct: 366 KFIKLSASILASPFTAIYNESIASGEVPDIFKISRVTPI 404 >SB_9212| Best HMM Match : RVT_1 (HMM E-Value=4.5e-36) Length = 449 Score = 54.4 bits (125), Expect = 9e-08 Identities = 29/83 (34%), Positives = 45/83 (54%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +NYRPIS++P +SKI E+ I QL ++ K NN+LH Q F ST ++ F Sbjct: 221 NNYRPISIIPVVSKICERTIFDQLYKYLKDNNILHECQSCFRSQYSTLNSLIEATNEWFL 280 Query: 461 SWEESHDCLGIFCDLSKHLTVLN 529 + ++ +F DL+K +N Sbjct: 281 NIDQGLINAVVFVDLAKAFDTVN 303 Score = 36.7 bits (81), Expect = 0.018 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 IS ++LK DI+ L ++ N I G++PD K SKV+P+ Sbjct: 170 ISCRLLKESADILCPSLTNLINLSIHTGLYPDKWKCSKVLPV 211 >SB_1875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 54.0 bits (124), Expect = 1e-07 Identities = 25/66 (37%), Positives = 40/66 (60%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRPIS++ + SKI EK+I QL+ + + +L QFGF +G ST A ++ + Sbjct: 38 PGNYRPISIICSFSKILEKLIYNQLIFFLEKHKILFEFQFGFRKGHSTEHAILETVETLK 97 Query: 458 QSWEES 475 S +++ Sbjct: 98 SSIDQA 103 >SB_53688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 491 Score = 53.6 bits (123), Expect = 2e-07 Identities = 24/51 (47%), Positives = 33/51 (64%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDA 430 P NYRPIS++ + SKI EK+I QL+ + + +L QFGF +G ST A Sbjct: 426 PGNYRPISIICSFSKILEKLIYNQLIFFLEKHKILFEFQFGFRKGHSTEHA 476 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 138 KVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 K +K I+AS +I+N+ I G PD+ K S+V P+ Sbjct: 379 KFIKLSASILASPFTAIYNESIASGEVPDIFKISRVTPI 417 >SB_48302| Best HMM Match : HORMA (HMM E-Value=1.1) Length = 330 Score = 53.6 bits (123), Expect = 2e-07 Identities = 24/51 (47%), Positives = 33/51 (64%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDA 430 P NYRPIS++ + SKI EK+I QL+ + + +L QFGF +G ST A Sbjct: 265 PGNYRPISIICSFSKILEKLIYNQLIFFLEKHKILFEFQFGFRKGHSTEHA 315 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 138 KVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 K +K I+AS +I+N+ I G PD+ K S+V P+ Sbjct: 218 KFIKLSASILASPFTAIYNESIASGEVPDIFKISRVTPI 256 >SB_58397| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 53.6 bits (123), Expect = 2e-07 Identities = 24/51 (47%), Positives = 33/51 (64%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDA 430 P NYRPIS++ + SKI EK+I QL+ + + +L QFGF +G ST A Sbjct: 217 PGNYRPISIICSFSKILEKLIYNQLIFFLEKHKILFEFQFGFRKGHSTEHA 267 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 138 KVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 K +K I+AS +I+N+ I G PD+ K S+V P+ Sbjct: 170 KFIKLSASILASPFTAIYNESIASGEVPDIFKISRVTPI 208 >SB_54849| Best HMM Match : HORMA (HMM E-Value=0.54) Length = 330 Score = 53.6 bits (123), Expect = 2e-07 Identities = 24/51 (47%), Positives = 33/51 (64%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDA 430 P NYRPIS++ + SKI EK+I QL+ + + +L QFGF +G ST A Sbjct: 265 PGNYRPISIICSFSKILEKLIYNQLIFFLEKHKILFEFQFGFRKGHSTEHA 315 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 138 KVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 K +K I+AS +I+N+ I G PD+ K S+V P+ Sbjct: 218 KFIKLSASILASPFTAIYNESIASGEVPDIFKISRVTPI 256 >SB_27891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 609 Score = 52.0 bits (119), Expect = 5e-07 Identities = 26/76 (34%), Positives = 43/76 (56%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+LP +SK+ E+ +L + +H L++N Q GF G+S T ++++I Sbjct: 495 NYRPISLLPVISKVLERCVLANIRDHL--TTLINNVQHGFLPGKSCTTQLLEVLRHIGSL 552 Query: 464 WEESHDCLGIFCDLSK 511 + I+ D+SK Sbjct: 553 LDNGKQTDVIYMDMSK 568 Score = 33.5 bits (73), Expect = 0.17 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 L+V + GI ++LK IA L ++N ++ GV PD K + +IP+ Sbjct: 432 LDVNEASGSDGIPCRLLKETAQQIAPSLTHLYNLSLRLGVVPDEWKLANIIPV 484 >SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1462 Score = 51.6 bits (118), Expect = 6e-07 Identities = 26/76 (34%), Positives = 42/76 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L SK+ E+ I ++++H + L N Q GF RGRST + ++ + Sbjct: 583 NYRPISLLSVTSKVLERCIFARMIDHV--SQYLSNCQHGFMRGRSTVTQLLEFLHSVGNA 640 Query: 464 WEESHDCLGIFCDLSK 511 ++ C I+ D +K Sbjct: 641 LDKGQRCDVIYLDFAK 656 >SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 943 Score = 51.6 bits (118), Expect = 6e-07 Identities = 26/76 (34%), Positives = 42/76 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L SK+ E+ I ++++H + L N Q GF RGRST + ++ + Sbjct: 174 NYRPISLLSVTSKVLERCIFARMIDHV--SQYLSNCQHGFMRGRSTVTQLLEFLHSVGNA 231 Query: 464 WEESHDCLGIFCDLSK 511 ++ C I+ D +K Sbjct: 232 LDKGQRCDVIYLDFAK 247 >SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) Length = 1799 Score = 51.2 bits (117), Expect = 8e-07 Identities = 26/76 (34%), Positives = 43/76 (56%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+LP +SK+ E+++ QL + +SN++ Q GF + ST A ++ ++ Sbjct: 1379 NYRPISILPDVSKVLERVVHQQLTAYLQSNSIFSPYQCGFRKRHSTEWAAICFADSVRRN 1438 Query: 464 WEESHDCLGIFCDLSK 511 + +F DLSK Sbjct: 1439 IDLGMMTGAMFIDLSK 1454 >SB_8622| Best HMM Match : RVT_1 (HMM E-Value=1.8e-35) Length = 308 Score = 51.2 bits (117), Expect = 8e-07 Identities = 26/85 (30%), Positives = 44/85 (51%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +++RP+S+LPTLSK+ E+++L QL+ H LL GF +G ST+ + + + Sbjct: 52 ADHRPVSILPTLSKLMERLVLHQLVTHINGEALLCPTISGFRKGHSTSSVLLGIRDALLR 111 Query: 461 SWEESHDCLGIFCDLSKHLTVLNMK 535 + L + D SK + K Sbjct: 112 ACSRGEVTLMVCADYSKAFDTVQFK 136 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 I VK +K + I+ + I N CI FP L K +++ P+ Sbjct: 1 IPVKFVKLAKEHISGPITHIINKCILTSNFPKLWKIARISPI 42 >SB_4381| Best HMM Match : RVT_1 (HMM E-Value=3) Length = 471 Score = 51.2 bits (117), Expect = 8e-07 Identities = 26/85 (30%), Positives = 44/85 (51%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +++RP+S+LPTLSK+ E+++L QL+ H LL GF +G ST+ + + + Sbjct: 284 ADHRPVSILPTLSKLMERLVLHQLVTHINGEALLCPTISGFRKGHSTSSVLLGIRDALLR 343 Query: 461 SWEESHDCLGIFCDLSKHLTVLNMK 535 + L + D SK + K Sbjct: 344 ACSRGEVTLMVCADYSKAFDTVQFK 368 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 I VK +K + I+ + I N CI FP L K +++ P+ Sbjct: 233 IPVKFVKLAKEHISGPITHIINKCILTSNFPKLWKIARISPI 274 >SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2209 Score = 50.8 bits (116), Expect = 1e-06 Identities = 26/76 (34%), Positives = 42/76 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+LP +SK+ E+ +L + +H L++N Q GF G+S T ++ +I Sbjct: 1570 NYRPISLLPVISKVLERCVLANIRDHL--TTLINNVQHGFLPGKSCTTQLLEVLHHIGSL 1627 Query: 464 WEESHDCLGIFCDLSK 511 + I+ D+SK Sbjct: 1628 LDNGKQTDVIYMDMSK 1643 Score = 33.5 bits (73), Expect = 0.17 Identities = 17/53 (32%), Positives = 27/53 (50%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 L+V GI ++LK IA L ++N ++ GV PD K + +IP+ Sbjct: 1507 LDVNKALGSNGIPCRLLKETAQQIAPSLTQLYNLSLRLGVVPDKWKLANIIPV 1559 >SB_6973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 50.0 bits (114), Expect = 2e-06 Identities = 26/85 (30%), Positives = 43/85 (50%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 ++ RP+S+LPTLSK+ E+++L QL+ H LL GF +G ST+ + + + Sbjct: 17 ADLRPVSILPTLSKLMERLVLHQLVTHINGEALLCPTISGFRKGHSTSSVLLGIRDALLR 76 Query: 461 SWEESHDCLGIFCDLSKHLTVLNMK 535 + L + D SK + K Sbjct: 77 ACSRGEVTLMVCADYSKAFDTVQFK 101 >SB_31593| Best HMM Match : Ribonuclease_3 (HMM E-Value=6.30024e-42) Length = 618 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/78 (28%), Positives = 40/78 (51%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRP+S+ L K+ E +I ++EH ++NN+L Q GF + S ++++ Sbjct: 294 PCNYRPVSLTTVLCKLMEHVIYKNIMEHLENNNILFANQHGFRKNHSCETQLLLTVEDLA 353 Query: 458 QSWEESHDCLGIFCDLSK 511 ++ + + D SK Sbjct: 354 RNTDNGGQIDMLILDFSK 371 >SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40) Length = 325 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/78 (28%), Positives = 40/78 (51%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRP+S+ L K+ E +I ++EH ++NN+L Q GF + S ++++ Sbjct: 112 PCNYRPVSLTTVLCKLMEHVIYKNIMEHLENNNILFANQHGFRKNHSCETQLLLTVEDLA 171 Query: 458 QSWEESHDCLGIFCDLSK 511 ++ + + D SK Sbjct: 172 RNTDNGGQIDMLILDFSK 189 >SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) Length = 593 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/58 (41%), Positives = 33/58 (56%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 SNYRPISVLP LSK+ E+ + ++ N LL+ Q GF R T A ++ N+ Sbjct: 138 SNYRPISVLPILSKLLERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNL 195 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LN++ + S K+LK IIA + + N I+ FP K +KV PL Sbjct: 76 LNLRKAMGIDKFSAKILKLAAPIIAPSISKLMNYSIESSEFPKRWKTAKVTPL 128 >SB_22068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 987 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/58 (41%), Positives = 33/58 (56%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 SNYRPISVLP LSK+ E+ + ++ N LL+ Q GF R T A ++ N+ Sbjct: 731 SNYRPISVLPILSKLLERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNL 788 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LN++ + S K+LK IIA + + N I+ FP K +KV PL Sbjct: 669 LNLRKAMGIDKFSAKILKLAAPIIAPSISKLMNYSIESSEFPKRWKTAKVTPL 721 >SB_12012| Best HMM Match : DUF327 (HMM E-Value=2) Length = 232 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/58 (41%), Positives = 33/58 (56%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 SNYRPISVLP LSK+ E+ + ++ N LL+ Q GF R T A ++ N+ Sbjct: 138 SNYRPISVLPILSKLLERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNL 195 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LN++ + K+LK IIA + + N I+ FP K +KV PL Sbjct: 76 LNLRKAMGIDKFIAKILKLAAPIIAPSISKLMNYSIESSEFPKRWKTAKVTPL 128 >SB_11753| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 393 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/78 (28%), Positives = 40/78 (51%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRP+S+ L K+ E +I ++EH ++NN+L Q GF + S ++++ Sbjct: 112 PCNYRPVSLTTVLCKLMEHVIYKNIMEHLENNNILFANQHGFRKNHSCETQLLLTVEDLA 171 Query: 458 QSWEESHDCLGIFCDLSK 511 ++ + + D SK Sbjct: 172 RNTDNGGQIDMLILDFSK 189 >SB_798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 845 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/58 (41%), Positives = 33/58 (56%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 SNYRPISVLP LSK+ E+ + ++ N LL+ Q GF R T A ++ N+ Sbjct: 666 SNYRPISVLPILSKLLERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNL 723 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LN++ + S K+LK IIA + + N I+ FP K +KV PL Sbjct: 604 LNLRKAMGIDKFSAKILKLAAPIIAPSISKLMNYSIESSEFPKRWKTAKVTPL 656 >SB_36163| Best HMM Match : RVT_1 (HMM E-Value=4.2e-11) Length = 258 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/58 (41%), Positives = 33/58 (56%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 SNYRPISVLP LSK+ E+ + ++ N LL+ Q GF R T A ++ N+ Sbjct: 57 SNYRPISVLPILSKLLERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNL 114 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +3 Query: 132 SVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 S K+LK IIA + + N I+ FP K +KV PL Sbjct: 7 SAKILKLAAPIIAPSISKLMNYSIESSEFPKRWKTAKVTPL 47 >SB_27268| Best HMM Match : RVT_1 (HMM E-Value=2.24208e-44) Length = 548 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/58 (41%), Positives = 33/58 (56%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 SNYRPISVLP LSK+ E+ + ++ N LL+ Q GF R T A ++ N+ Sbjct: 270 SNYRPISVLPILSKLLERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNL 327 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LN++ + S K+LK IIA + + N I+ FP K +KV PL Sbjct: 208 LNLRKAMGIDKFSAKILKLAAPIIAPSISKLMNYSIESSEFPKRWKTAKVTPL 260 >SB_24534| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 423 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/78 (28%), Positives = 40/78 (51%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRP+S+ L K+ E +I ++EH ++NN+L Q GF + S ++++ Sbjct: 112 PCNYRPVSLTTVLCKLMEHVIYKNIMEHLENNNILFANQHGFRKNHSCETQLLLTVEDLA 171 Query: 458 QSWEESHDCLGIFCDLSK 511 ++ + + D SK Sbjct: 172 RNTDNGGQIDMLILDFSK 189 >SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) Length = 890 Score = 49.6 bits (113), Expect = 2e-06 Identities = 24/58 (41%), Positives = 33/58 (56%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 SNYRPISVLP LSK+ E+ + ++ N LL+ Q GF R T A ++ N+ Sbjct: 435 SNYRPISVLPILSKLLERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNL 492 Score = 31.9 bits (69), Expect = 0.52 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LN++ + S ++LK IIA + + N I+ FP K +KV PL Sbjct: 373 LNLRKAMGIDKFSARILKLAAPIIAPSISKLMNYSIESSEFPKRWKTAKVTPL 425 >SB_58171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/58 (41%), Positives = 33/58 (56%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 SNYRPISVLP LSK+ E+ + ++ N LL+ Q GF R T A ++ N+ Sbjct: 343 SNYRPISVLPILSKLVERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNL 400 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LN++ + S K+LK IIA + + N I+ FP K +KV PL Sbjct: 281 LNLRKAMGIDKFSAKILKLAAPIIAPSISKLMNYSIESSEFPKRWKTAKVTPL 333 >SB_39669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/58 (41%), Positives = 33/58 (56%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 SNYRPISVLP LSK+ E+ + ++ N LL+ Q GF R T A ++ N+ Sbjct: 288 SNYRPISVLPILSKLVERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNL 345 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LN++ + S K+LK IIA + + N I+ FP K +KV PL Sbjct: 226 LNLRKAMGIDKFSAKILKLAAPIIAPSISKLMNYSIESSEFPKRWKTAKVTPL 278 >SB_56454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 49.2 bits (112), Expect = 3e-06 Identities = 30/77 (38%), Positives = 41/77 (53%), Gaps = 1/77 (1%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 N+R IS+L KI +I+L +LL H + N LL Q GF GR T D + K + + Sbjct: 105 NHRGISLLSIAGKILARILLNRLLRHLE-NGLLPESQCGFRAGRGTVDM-IFAAKQLQEK 162 Query: 464 WEESHDCL-GIFCDLSK 511 +E H L F DL+K Sbjct: 163 CQEQHTALFTTFVDLTK 179 >SB_53800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 666 Score = 49.2 bits (112), Expect = 3e-06 Identities = 24/58 (41%), Positives = 33/58 (56%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 SNYRPISVLP LSK+ E+ + ++ N LL+ Q GF R T A ++ N+ Sbjct: 487 SNYRPISVLPILSKLVERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNL 544 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LN++ + S K+LK IIA + + N I+ FP K +KV PL Sbjct: 425 LNLRKAMGIDKFSAKILKLAAPIIAPSISKLMNYSIESSEFPKRWKTAKVTPL 477 >SB_47788| Best HMM Match : Cir_Bir_Yir (HMM E-Value=8.6) Length = 294 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/48 (43%), Positives = 33/48 (68%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTT 424 +++RP+S+LPTLSK+ E+++L QL+ H LL GF +G ST+ Sbjct: 235 ADHRPVSILPTLSKLMERLVLHQLVTHINGEALLCPTISGFRKGHSTS 282 >SB_27170| Best HMM Match : RVT_1 (HMM E-Value=1.3e-31) Length = 265 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/48 (43%), Positives = 33/48 (68%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTT 424 +++RP+S+LPTLSK+ E+++L QL+ H LL GF +G ST+ Sbjct: 52 ADHRPVSILPTLSKLMERLVLHQLVTHINGEALLCPTISGFRKGHSTS 99 >SB_24501| Best HMM Match : RVT_1 (HMM E-Value=4.2e-37) Length = 565 Score = 49.2 bits (112), Expect = 3e-06 Identities = 30/77 (38%), Positives = 41/77 (53%), Gaps = 1/77 (1%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 N+R IS+L KI +I+L +LL H + N LL Q GF GR T D + K + + Sbjct: 65 NHRGISLLSIAGKILARILLNRLLRHLE-NGLLPESQCGFRAGRGTVDM-IFAAKQLQEK 122 Query: 464 WEESHDCL-GIFCDLSK 511 +E H L F DL+K Sbjct: 123 CQEQHTALFTTFVDLTK 139 >SB_36088| Best HMM Match : RVT_1 (HMM E-Value=9e-12) Length = 471 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/58 (41%), Positives = 32/58 (55%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 SNYRPISVLP LSK+ E+ + ++ N LL+ Q GF R T A + N+ Sbjct: 270 SNYRPISVLPILSKLLERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKAVDNL 327 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LN++ + S K+LK IIA + + N I+ FP K +KV PL Sbjct: 208 LNLRKAMGIDKFSAKILKLAAPIIAPSISKLMNYSIESSEFPKRWKTAKVTPL 260 >SB_57858| Best HMM Match : RNA_pol_A_CTD (HMM E-Value=5.7) Length = 280 Score = 48.8 bits (111), Expect = 4e-06 Identities = 19/47 (40%), Positives = 29/47 (61%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRP+S+ L K+ E +I ++EH ++NN+L Q GF + S Sbjct: 204 PCNYRPVSLTTVLCKLMEHVIYKNIMEHLENNNILFANQHGFRKNHS 250 >SB_1758| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 359 Score = 48.4 bits (110), Expect = 6e-06 Identities = 21/42 (50%), Positives = 29/42 (69%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGF 403 P+NYRPIS+ KI E IIL+ + +H S+N+L N+Q GF Sbjct: 98 PANYRPISLTSICCKIMEHIILSHMAKHLSSHNILINQQHGF 139 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 48.4 bits (110), Expect = 6e-06 Identities = 21/42 (50%), Positives = 29/42 (69%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGF 403 P+NYRPIS+ KI E IIL+ + +H S+N+L N+Q GF Sbjct: 673 PANYRPISLTSICCKIMEHIILSHMAKHLSSHNILINQQHGF 714 >SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 801 Score = 48.4 bits (110), Expect = 6e-06 Identities = 21/42 (50%), Positives = 29/42 (69%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGF 403 P+NYRPIS+ KI E IIL+ + +H S+N+L N+Q GF Sbjct: 399 PANYRPISLTSICCKIMEHIILSHMAKHLSSHNILINQQHGF 440 >SB_10781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 48.4 bits (110), Expect = 6e-06 Identities = 21/42 (50%), Positives = 29/42 (69%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGF 403 P+NYRPIS+ KI E IIL+ + +H S+N+L N+Q GF Sbjct: 196 PANYRPISLTSICCKIMEHIILSHMAKHLSSHNILINQQHGF 237 >SB_34658| Best HMM Match : SUI1 (HMM E-Value=1e-06) Length = 798 Score = 47.6 bits (108), Expect = 1e-05 Identities = 26/75 (34%), Positives = 41/75 (54%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 N+RP+S LP +SK+ EK + QL +H SNNL + Q + + ST A + +I + Sbjct: 611 NFRPVSNLPMVSKVIEKAVAEQLTKHIVSNNLDVSLQSSYNKFHSTKTALIKVQNDILCA 670 Query: 464 WEESHDCLGIFCDLS 508 + + L + DLS Sbjct: 671 IDGGNSVLMLLLDLS 685 >SB_22968| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1332 Score = 47.6 bits (108), Expect = 1e-05 Identities = 26/75 (34%), Positives = 41/75 (54%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 N+RP+S LP +SK+ EK + QL +H SNNL + Q + + ST A + +I + Sbjct: 635 NFRPVSNLPMVSKVIEKAVAEQLTKHIVSNNLDVSPQSSYEKFNSTETALIKVQNDILCT 694 Query: 464 WEESHDCLGIFCDLS 508 + + L + DLS Sbjct: 695 IDGGNSVLMLLLDLS 709 >SB_14807| Best HMM Match : RVT_1 (HMM E-Value=2.2) Length = 281 Score = 47.6 bits (108), Expect = 1e-05 Identities = 26/75 (34%), Positives = 41/75 (54%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 N+RP+S LP +SK+ EK + QL +H SNNL + Q + + ST A + +I + Sbjct: 98 NFRPVSNLPMVSKVIEKAVAEQLTKHIVSNNLDVSPQSSYKKFHSTETALIKVQNDILCA 157 Query: 464 WEESHDCLGIFCDLS 508 + + L + DLS Sbjct: 158 IDGGNSVLMLLLDLS 172 >SB_3017| Best HMM Match : RVT_1 (HMM E-Value=1.1e-19) Length = 522 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/44 (50%), Positives = 27/44 (61%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTR 409 PSNYRPIS+ KIFE II ++ H +NN+L Q GF R Sbjct: 319 PSNYRPISLTAVPCKIFEHIIFHDIMNHLDTNNILVKFQHGFRR 362 >SB_33293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 47.2 bits (107), Expect = 1e-05 Identities = 26/75 (34%), Positives = 41/75 (54%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 N+RP+S LP +SK+ EK + QL +H SNNL + Q + + ST A + +I + Sbjct: 26 NFRPVSNLPMVSKVIEKAVAEQLTKHIVSNNLDVSLQSSYKKFHSTETALIKVQNDILCA 85 Query: 464 WEESHDCLGIFCDLS 508 + + L + DLS Sbjct: 86 IDGGNSVLMLLLDLS 100 >SB_30053| Best HMM Match : RVT_1 (HMM E-Value=2.3e-24) Length = 232 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/50 (44%), Positives = 32/50 (64%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDA 430 +NYRPISV ++KIFE+I+ QL ++ N+L+ + Q GF ST A Sbjct: 9 NNYRPISVTSIVAKIFERIVYEQLYDYLSENHLISSFQSGFPSLHSTVTA 58 >SB_31930| Best HMM Match : RVT_1 (HMM E-Value=1.3e-33) Length = 405 Score = 47.2 bits (107), Expect = 1e-05 Identities = 25/75 (33%), Positives = 39/75 (52%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 +YRP+S L +SK EK+ +L EH +NNLL Q + G ST A +++ +I Sbjct: 152 HYRPVSNLRFISKALEKVAAVRLREHCDNNNLLERYQSAYREGHSTETALSHIHNDILCE 211 Query: 464 WEESHDCLGIFCDLS 508 + + + DLS Sbjct: 212 IDSGKCVILVLLDLS 226 >SB_24580| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 366 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/63 (36%), Positives = 36/63 (57%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+LP LSKI E+ + QL S+ L+ ++Q GF S A L+ + ++ Sbjct: 39 NYRPISILPILSKILERHVHVQLYAFLNSHQLITHRQSGFRPYHSCETAMIELVDTLLKN 98 Query: 464 WEE 472 ++ Sbjct: 99 MDD 101 >SB_48125| Best HMM Match : RVT_1 (HMM E-Value=8.4e-38) Length = 453 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/50 (42%), Positives = 31/50 (62%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDA 430 +NYRPISV P ++KIFE+ + Q ++ N+L+ + Q GF ST A Sbjct: 80 NNYRPISVTPIVAKIFERTVYEQFYDYLSENHLISSFQSGFRSLHSTVTA 129 >SB_35000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/48 (41%), Positives = 31/48 (64%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRST 421 PSNYRPIS+L LSK+ E+ + L + N+LL+++Q F + +T Sbjct: 62 PSNYRPISILSVLSKVIERHVHDSLYTYLNDNSLLYSRQSDFRKHHNT 109 >SB_59377| Best HMM Match : Exo_endo_phos (HMM E-Value=1.7) Length = 839 Score = 46.4 bits (105), Expect = 2e-05 Identities = 23/79 (29%), Positives = 46/79 (58%), Gaps = 2/79 (2%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKS--NNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 ++ RPIS+LP LSK++E+++L Q+ + S +++L + + +G STT + + +I Sbjct: 679 NDLRPISILPVLSKVYERLVLGQMSDFVSSGPDSILKDTVSAYRKGHSTTTSLLAIKDDI 738 Query: 455 FQSWEESHDCLGIFCDLSK 511 ++ + L + D SK Sbjct: 739 TKAMKRGEVTLAVLADFSK 757 Score = 33.1 bits (72), Expect = 0.23 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 I VK +K D +AS L I N CI FP K +++ P+ Sbjct: 628 IPVKFIKHAADHLASPLTHILNTCISQEYFPSAWKVARISPI 669 >SB_59080| Best HMM Match : RVT_1 (HMM E-Value=1.2e-35) Length = 318 Score = 46.4 bits (105), Expect = 2e-05 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 1/77 (1%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ- 460 N+R IS+L +KIF +++L +LL+H + + L Q GF GR T D + + I + Sbjct: 28 NHRGISLLSIAAKIFARLLLNRLLKHLEQGH-LPESQCGFRAGRGTVDM-IFAARQIQEK 85 Query: 461 SWEESHDCLGIFCDLSK 511 S E++ D F DL+K Sbjct: 86 SVEQNQDLYTTFVDLTK 102 >SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1273 Score = 46.4 bits (105), Expect = 2e-05 Identities = 25/78 (32%), Positives = 41/78 (52%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P+NYRPIS+ SK+ E II + +++H + +L + Q GF RST I ++ Sbjct: 637 PANYRPISLTCIASKVLEHIIHSHVMKHLQHYGILTDVQHGFRAKRSTVTQLILTIHDMA 696 Query: 458 QSWEESHDCLGIFCDLSK 511 ++ +E+ D SK Sbjct: 697 KAIQENKSIHAAVLDFSK 714 >SB_41718| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) Length = 470 Score = 46.4 bits (105), Expect = 2e-05 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 1/77 (1%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ- 460 N+R IS+L +KIF +++L +LL+H + + L Q GF GR T D + + I + Sbjct: 87 NHRGISLLSIAAKIFARLLLNRLLKHLEQGH-LPESQCGFRAGRGTVDM-IFAARQIQEK 144 Query: 461 SWEESHDCLGIFCDLSK 511 S E++ D F DL+K Sbjct: 145 SVEQNQDLYTTFVDLTK 161 >SB_37650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 46.4 bits (105), Expect = 2e-05 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 1/77 (1%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ- 460 N+R IS+L +KIF +++L +LL+H + + L Q GF GR T D + + I + Sbjct: 73 NHRGISLLSIAAKIFARLLLNRLLKHLEQGH-LPESQCGFRAGRGTVDM-IFAARQIQEK 130 Query: 461 SWEESHDCLGIFCDLSK 511 S E++ D F DL+K Sbjct: 131 SVEQNQDLYTTFVDLTK 147 >SB_35561| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00092) Length = 813 Score = 46.4 bits (105), Expect = 2e-05 Identities = 23/79 (29%), Positives = 46/79 (58%), Gaps = 2/79 (2%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKS--NNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 ++ RPIS+LP LSK++E+++L Q+ + S +++L + + +G STT + + +I Sbjct: 653 NDLRPISILPVLSKVYERLVLGQMSDFVSSGPDSILKDTVSAYRKGHSTTTSLLAIKDDI 712 Query: 455 FQSWEESHDCLGIFCDLSK 511 ++ + L + D SK Sbjct: 713 TKAMKRGEVTLAVLADFSK 731 Score = 33.1 bits (72), Expect = 0.23 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 I VK +K D +AS L I N CI FP K +++ P+ Sbjct: 602 IPVKFIKHAADHLASPLTHILNTCISQEYFPSAWKVARISPI 643 >SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 291 Score = 46.4 bits (105), Expect = 2e-05 Identities = 25/63 (39%), Positives = 35/63 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+LP LSK+ E+ I L E+ S+ LL + Q GF S A LI + + Sbjct: 106 NYRPISILPALSKVIERHIHVCLYEYLNSHKLLSSNQSGFRPYHSCDTALVKLIDYLIGN 165 Query: 464 WEE 472 ++ Sbjct: 166 MDQ 168 Score = 37.5 bits (83), Expect = 0.011 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = +3 Query: 126 GISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 GIS ++L++ IA L I N IK G FP K +KV P+ Sbjct: 53 GISARLLRAAAPAIAPSLTKIINQSIKTGRFPTRWKEAKVCPI 95 >SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 46.4 bits (105), Expect = 2e-05 Identities = 25/63 (39%), Positives = 35/63 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+LP LSK+ E+ I L E+ S+ LL + Q GF S A LI + + Sbjct: 106 NYRPISILPALSKVIERHIHVCLYEYLNSHKLLSSNQSGFRPYHSCDTALVKLIDYLIGN 165 Query: 464 WEE 472 ++ Sbjct: 166 MDQ 168 >SB_19821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 46.4 bits (105), Expect = 2e-05 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 1/77 (1%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ- 460 N+R IS+L +KIF +++L +LL+H + + L Q GF GR T D + + I + Sbjct: 22 NHRGISLLSIAAKIFARLLLNRLLKHLEQGH-LPESQCGFRAGRGTVDM-IFAARQIQEK 79 Query: 461 SWEESHDCLGIFCDLSK 511 S E++ D F DL+K Sbjct: 80 SVEQNQDLYTTFVDLTK 96 >SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 907 Score = 46.4 bits (105), Expect = 2e-05 Identities = 26/77 (33%), Positives = 38/77 (49%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 SNYRPIS+ KI E I+ L+ H SNN+L + Q GF + S ++ + Sbjct: 587 SNYRPISLTSITCKIMEHILFRHLMSHLDSNNILLHIQHGFRKKYSCETQLITVLHELCY 646 Query: 461 SWEESHDCLGIFCDLSK 511 S ++ + I D SK Sbjct: 647 SLDQGNQTDCILLDFSK 663 >SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 377 Score = 46.4 bits (105), Expect = 2e-05 Identities = 25/63 (39%), Positives = 35/63 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+LP LSK+ E+ I L E+ S+ LL + Q GF S A LI + + Sbjct: 192 NYRPISILPALSKVIERHIHVCLYEYLNSHKLLSSNQSGFRPYHSCDTALVKLIDYLIGN 251 Query: 464 WEE 472 ++ Sbjct: 252 MDQ 254 >SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 864 Score = 46.4 bits (105), Expect = 2e-05 Identities = 25/78 (32%), Positives = 41/78 (52%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P+NYRPIS+ SK+ E II + +++H + +L + Q GF RST I ++ Sbjct: 359 PANYRPISLTCIASKVLEHIIHSHVMKHLQHYGILTDVQHGFRAKRSTVTQLILTIHDMA 418 Query: 458 QSWEESHDCLGIFCDLSK 511 ++ +E+ D SK Sbjct: 419 KAIQENKSIHAAVLDFSK 436 >SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) Length = 863 Score = 46.4 bits (105), Expect = 2e-05 Identities = 25/78 (32%), Positives = 41/78 (52%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P+NYRPIS+ SK+ E II + +++H + +L + Q GF RST I ++ Sbjct: 476 PANYRPISLTCIASKVLEHIIHSHVMKHLQHYGILTDVQHGFRAKRSTVTQLILTIHDMA 535 Query: 458 QSWEESHDCLGIFCDLSK 511 ++ +E+ D SK Sbjct: 536 KAIQENKSIHAAVLDFSK 553 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 46.4 bits (105), Expect = 2e-05 Identities = 25/78 (32%), Positives = 41/78 (52%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P+NYRPIS+ SK+ E II + +++H + +L + Q GF RST I ++ Sbjct: 149 PANYRPISLTCIASKVLEHIIHSHVMKHLQHYGILTDVQHGFRAKRSTVTQLILTIHDMA 208 Query: 458 QSWEESHDCLGIFCDLSK 511 ++ +E+ D SK Sbjct: 209 KAIQENKSIHAAVLDFSK 226 >SB_32334| Best HMM Match : UPF0058 (HMM E-Value=4.6) Length = 311 Score = 46.4 bits (105), Expect = 2e-05 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 1/77 (1%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ- 460 N+R IS+L +KIF +++L +LL+H + + L Q GF GR T D + + I + Sbjct: 233 NHRGISLLSIAAKIFARLLLNRLLKHLEQGH-LPESQCGFRAGRGTVDM-IFAARQIQEK 290 Query: 461 SWEESHDCLGIFCDLSK 511 S E++ D F DL+K Sbjct: 291 SVEQNQDLYTTFVDLTK 307 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 46.4 bits (105), Expect = 2e-05 Identities = 25/78 (32%), Positives = 41/78 (52%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P+NYRPIS+ SK+ E II + +++H + +L + Q GF RST I ++ Sbjct: 234 PANYRPISLTCIASKVLEHIIHSHVMKHLQHYGILTDVQHGFRAKRSTVTQLILTIHDMA 293 Query: 458 QSWEESHDCLGIFCDLSK 511 ++ +E+ D SK Sbjct: 294 KAIQENKSIHAAVLDFSK 311 >SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 546 Score = 46.4 bits (105), Expect = 2e-05 Identities = 25/78 (32%), Positives = 41/78 (52%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P+NYRPIS+ SK+ E II + +++H + +L + Q GF RST I ++ Sbjct: 167 PANYRPISLTCIASKVLEHIIHSHVMKHLQHYGILTDVQHGFRAKRSTVTQLILTIHDMA 226 Query: 458 QSWEESHDCLGIFCDLSK 511 ++ +E+ D SK Sbjct: 227 KAIQENKSIHAAVLDFSK 244 >SB_17732| Best HMM Match : RVT_1 (HMM E-Value=1.5e-27) Length = 399 Score = 46.4 bits (105), Expect = 2e-05 Identities = 23/71 (32%), Positives = 36/71 (50%) Frame = +2 Query: 317 SKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQSWEESHDCLGIF 496 SK FEK++ +L NN+L + Q+GF + ST A L + + + +G+F Sbjct: 67 SKFFEKVVYKRLYNFLLKNNILFDNQYGFRKHHSTALALLQLYDKLSAAIDNREYTIGVF 126 Query: 497 CDLSKHLTVLN 529 DLSK +N Sbjct: 127 IDLSKAFDTVN 137 >SB_6922| Best HMM Match : RVT_1 (HMM E-Value=1.4e-34) Length = 425 Score = 46.4 bits (105), Expect = 2e-05 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 1/77 (1%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ- 460 N+R IS+L +KIF +++L +LL+H + + L Q GF GR T D + + I + Sbjct: 28 NHRGISLLSIAAKIFARLLLNRLLKHLEQGH-LPESQCGFRAGRGTVDM-IFAARQIQEK 85 Query: 461 SWEESHDCLGIFCDLSK 511 S E++ D F DL+K Sbjct: 86 SVEQNQDLYTTFVDLTK 102 >SB_3609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 46.0 bits (104), Expect = 3e-05 Identities = 33/81 (40%), Positives = 44/81 (54%), Gaps = 4/81 (4%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +NYRP+SVL T+ KIFE++ QL + F + N GF RG S A LIK + + Sbjct: 8 TNYRPVSVLSTIPKIFERLQFDQLYDAFAM--VFSNNMSGFLRGHSCCSA---LIK-LTE 61 Query: 461 SWEESHD---CLGIFC-DLSK 511 W S D +G+ DLSK Sbjct: 62 DWRASLDKRESVGVVAIDLSK 82 >SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 789 Score = 46.0 bits (104), Expect = 3e-05 Identities = 25/63 (39%), Positives = 35/63 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+LP LSK+ E+ I L E+ S+ LL + Q GF S A LI + + Sbjct: 520 NYRPISILPALSKVIERHIHVCLYEYLNSHKLLSSNQSGFRPYHSCDTALIKLIDYLIGN 579 Query: 464 WEE 472 ++ Sbjct: 580 MDQ 582 >SB_37633| Best HMM Match : DUF327 (HMM E-Value=2.1) Length = 355 Score = 46.0 bits (104), Expect = 3e-05 Identities = 23/58 (39%), Positives = 32/58 (55%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 S YRPISVLP LSK+ E+ + ++ N LL+ Q GF R T A ++ N+ Sbjct: 253 SIYRPISVLPILSKLLERHVHNHFYDYLVENKLLYASQSGFRRHHGTETALIKVVDNL 310 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LN++ + S K+LK IIA + + N I+ FP K +KV PL Sbjct: 191 LNLRKAMGIDKFSAKILKLAAPIIAPSISKLMNYSIESSEFPKRWKTAKVTPL 243 >SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1702 Score = 46.0 bits (104), Expect = 3e-05 Identities = 18/49 (36%), Positives = 29/49 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTT 424 P NYRP+S+ + K+ E I+ QL H ++++ + Q GF +G S T Sbjct: 394 PKNYRPVSLTSLVCKVMEHIVCKQLTSHLSEHSIISHHQHGFQKGLSCT 442 >SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) Length = 407 Score = 46.0 bits (104), Expect = 3e-05 Identities = 25/63 (39%), Positives = 35/63 (55%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+LP LSK+ E+ I L E+ S+ LL + Q GF S A LI + + Sbjct: 106 NYRPISILPALSKVIERHIHVCLYEYLNSHKLLSSNQSGFRPYHSCDTALIKLIDYLIGN 165 Query: 464 WEE 472 ++ Sbjct: 166 MDQ 168 >SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 533 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/47 (38%), Positives = 29/47 (61%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRP+S+ +SK+ E I+ ++ H +NN++ Q GF +G S Sbjct: 158 PQNYRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGFLKGLS 204 >SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1025 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/47 (38%), Positives = 29/47 (61%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRP+S+ +SK+ E I+ ++ H +NN++ Q GF +G S Sbjct: 670 PQNYRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGFLKGLS 716 >SB_41660| Best HMM Match : PyrI_C (HMM E-Value=4.6) Length = 367 Score = 45.6 bits (103), Expect = 4e-05 Identities = 25/75 (33%), Positives = 41/75 (54%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 N+RP+S LP +SK+ +K + QL +H SNNL + Q + + ST A + +I + Sbjct: 177 NFRPVSNLPMVSKVIKKAVAEQLTKHIVSNNLDVSLQSSYKKFHSTETALIKVQNDILCA 236 Query: 464 WEESHDCLGIFCDLS 508 + + L + DLS Sbjct: 237 IDGGNSVLMLLLDLS 251 >SB_37835| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 295 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/47 (38%), Positives = 29/47 (61%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRP+S+ +SK+ E I+ ++ H +NN++ Q GF +G S Sbjct: 68 PQNYRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGFLKGLS 114 >SB_37247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 45.6 bits (103), Expect = 4e-05 Identities = 25/75 (33%), Positives = 40/75 (53%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 N+RP+S LP S++ EK + QL +H SNNL + Q + + ST A + +I + Sbjct: 26 NFRPVSNLPMFSRVIEKAVAEQLTKHIVSNNLDVSLQSSYKKFHSTETALIKVQNDILCA 85 Query: 464 WEESHDCLGIFCDLS 508 + + L + DLS Sbjct: 86 IDGGNSVLMLLLDLS 100 >SB_22944| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2468 Score = 45.6 bits (103), Expect = 4e-05 Identities = 25/75 (33%), Positives = 41/75 (54%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 N+RP+S LP +SK+ +K + QL +H SNNL + Q + + ST A + +I + Sbjct: 2278 NFRPVSNLPMVSKVIKKAVAEQLTKHIVSNNLDVSLQSSYKKFHSTETALIKVQNDILCA 2337 Query: 464 WEESHDCLGIFCDLS 508 + + L + DLS Sbjct: 2338 IDGGNSVLMLLLDLS 2352 >SB_5148| Best HMM Match : RVT_1 (HMM E-Value=1.7e-27) Length = 286 Score = 45.6 bits (103), Expect = 4e-05 Identities = 26/75 (34%), Positives = 40/75 (53%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 N+RP S LP +SK+ EK + QL +H SNNL + Q + + ST A + +I + Sbjct: 26 NFRPASNLPMVSKVIEKAVAEQLTKHIVSNNLDVSLQSSYKKFHSTETALIKVQNDILCA 85 Query: 464 WEESHDCLGIFCDLS 508 + + L + DLS Sbjct: 86 IDGGNSVLMLLLDLS 100 >SB_576| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1444 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/79 (29%), Positives = 46/79 (58%), Gaps = 2/79 (2%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKS--NNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 ++ RPIS+LP LSK++E+++L Q+ + S +++L + + +G STT + + +I Sbjct: 736 NDLRPISILPVLSKVYERLVLGQMSDFVSSGPDSILKDTVSAYRKGYSTTTSLLAIKDDI 795 Query: 455 FQSWEESHDCLGIFCDLSK 511 ++ + L + D SK Sbjct: 796 TKAMKRGEVTLAVLADFSK 814 Score = 33.1 bits (72), Expect = 0.23 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +3 Query: 126 GISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 G VK +K D +AS L I N CI FP K +++ P+ Sbjct: 684 GSPVKFIKHAADHLASPLTHILNTCISQEYFPSAWKVARISPI 726 >SB_52564| Best HMM Match : Exo_endo_phos (HMM E-Value=3.2e-09) Length = 748 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/47 (38%), Positives = 29/47 (61%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRP+S+ +SK+ E I+ ++ H +NN++ Q GF +G S Sbjct: 632 PQNYRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGFLKGLS 678 >SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) Length = 823 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/47 (38%), Positives = 29/47 (61%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRP+S+ +SK+ E I+ ++ H +NN++ Q GF +G S Sbjct: 159 PQNYRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGFLKGLS 205 >SB_30833| Best HMM Match : RVT_1 (HMM E-Value=3.50044e-42) Length = 275 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/47 (38%), Positives = 29/47 (61%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRP+S+ +SK+ E I+ ++ H +NN++ Q GF +G S Sbjct: 67 PQNYRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGFLKGLS 113 >SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1009 Score = 45.6 bits (103), Expect = 4e-05 Identities = 18/47 (38%), Positives = 29/47 (61%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRP+S+ +SK+ E I+ ++ H +NN++ Q GF +G S Sbjct: 602 PQNYRPVSLTSLVSKLMEHIVSKHIMCHLSANNIITQLQHGFLKGLS 648 >SB_53427| Best HMM Match : RVT_1 (HMM E-Value=0.031) Length = 969 Score = 45.2 bits (102), Expect = 5e-05 Identities = 25/77 (32%), Positives = 38/77 (49%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 SNYRPIS+ KI E I+ L+ H SNN+L + Q GF + S ++ + Sbjct: 731 SNYRPISLTSITCKIMEHILFRHLMSHLDSNNILLHIQHGFRKKYSCETQLITVLHKLCY 790 Query: 461 SWEESHDCLGIFCDLSK 511 + ++ + I D SK Sbjct: 791 NLDQGNQTDCILLDFSK 807 >SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 45.2 bits (102), Expect = 5e-05 Identities = 25/77 (32%), Positives = 38/77 (49%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 SNYRPIS+ KI E I+ L+ H SNN+L + Q GF + S ++ + Sbjct: 102 SNYRPISLTSITCKIMEHILFRHLMSHLDSNNILLHIQHGFRKKYSCETQLITVLHELCY 161 Query: 461 SWEESHDCLGIFCDLSK 511 + ++ + I D SK Sbjct: 162 NLDQGNQTDCILLDFSK 178 >SB_36120| Best HMM Match : zf-MIZ (HMM E-Value=3.9) Length = 209 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/47 (40%), Positives = 29/47 (61%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ K+ E ++L+ L +H ++N++ N Q GF G S Sbjct: 85 PGNYRPISLTCLACKVMEHVVLSHLNKHLAAHNIISNLQHGFRAGFS 131 >SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 522 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/47 (40%), Positives = 29/47 (61%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ K+ E ++L+ L +H ++N++ N Q GF G S Sbjct: 85 PGNYRPISLTCLACKVMEHVVLSHLNKHLAAHNIISNLQHGFRAGFS 131 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/48 (43%), Positives = 33/48 (68%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRST 421 PSNYRPIS+L LSK+ E+ + L + ++NLL+++Q GF + +T Sbjct: 2114 PSNYRPISILSVLSKVIERHVHDSLCTYL-NDNLLYSRQSGFWKHHNT 2160 >SB_15607| Best HMM Match : zf-MIZ (HMM E-Value=3.9) Length = 221 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/47 (40%), Positives = 29/47 (61%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ K+ E ++L+ L +H ++N++ N Q GF G S Sbjct: 118 PGNYRPISLTCLACKVMEHVVLSHLNKHLAAHNIISNLQHGFRAGFS 164 >SB_59500| Best HMM Match : RVT_1 (HMM E-Value=0.015) Length = 224 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/47 (40%), Positives = 29/47 (61%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ K+ E ++L+ L +H ++N++ N Q GF G S Sbjct: 35 PGNYRPISLTCLACKVMEHVVLSHLNKHLAAHNIISNLQHGFRAGFS 81 >SB_51232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1676 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/47 (40%), Positives = 29/47 (61%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ K+ E ++L+ L +H ++N++ N Q GF G S Sbjct: 707 PGNYRPISLTCLACKVMEHVVLSHLNKHLAAHNIISNLQHGFRAGFS 753 >SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1230 Score = 45.2 bits (102), Expect = 5e-05 Identities = 25/77 (32%), Positives = 38/77 (49%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 SNYRPIS+ KI E I+ L+ H SNN+L + Q GF + S ++ + Sbjct: 956 SNYRPISLTSITCKIMEHILFRHLMSHLDSNNILLHIQHGFRKKYSCETQLITVLHELCY 1015 Query: 461 SWEESHDCLGIFCDLSK 511 + ++ + I D SK Sbjct: 1016 NLDQGNQTDCILLDFSK 1032 >SB_20001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 722 Score = 45.2 bits (102), Expect = 5e-05 Identities = 22/66 (33%), Positives = 35/66 (53%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+LP +SK+ E+I+ Q+ + N LL+ Q G + L N+F Sbjct: 10 NYRPISILPAISKVIERIVYEQVYDFLTENQLLNRCQSGLRDLWLRNMDQSLLTANVFND 69 Query: 464 WEESHD 481 +++ D Sbjct: 70 LKKAFD 75 >SB_11067| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1176 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/47 (40%), Positives = 29/47 (61%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ K+ E ++L+ L +H ++N++ N Q GF G S Sbjct: 791 PGNYRPISLTCLACKVMEHVVLSHLNKHLAAHNIISNLQHGFRAGFS 837 >SB_39386| Best HMM Match : RVT_1 (HMM E-Value=7.1e-28) Length = 1239 Score = 44.8 bits (101), Expect = 7e-05 Identities = 22/79 (27%), Positives = 46/79 (58%), Gaps = 2/79 (2%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKS--NNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 ++ RPIS+LP LS+++E+++L Q+ + S +++L + + +G STT + + +I Sbjct: 444 NDLRPISILPVLSEVYERLVLGQMSDFVSSGPDSILKDTVSAYRKGHSTTTSLLAIKDDI 503 Query: 455 FQSWEESHDCLGIFCDLSK 511 ++ + L + D SK Sbjct: 504 TKAMKRGEVTLAVLADFSK 522 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +3 Query: 126 GISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 GI V +K D +AS L I N CI FP K +++ P+ Sbjct: 392 GIPVTFIKHAADHLASPLTHILNTCILQEYFPSAWKVARISPI 434 >SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 931 Score = 44.8 bits (101), Expect = 7e-05 Identities = 29/79 (36%), Positives = 41/79 (51%), Gaps = 1/79 (1%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 PSNYRPIS+ K+ E I+L+ L +H + N+L + Q GF G S + L + + Sbjct: 462 PSNYRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGFRSGFS-CETQLILATHDW 520 Query: 458 QSWEESHDCL-GIFCDLSK 511 S SH + I D SK Sbjct: 521 ASTLNSHGQVDAIMLDFSK 539 >SB_483| Best HMM Match : SAM_1 (HMM E-Value=2.4e-13) Length = 273 Score = 44.8 bits (101), Expect = 7e-05 Identities = 30/82 (36%), Positives = 39/82 (47%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPLLNLVVLM 275 +N+K GI K +K D I L IFN + G F + K SKV P Sbjct: 112 INLKENKSAIGIPRKCVKLAADQINEALTIIFNQSLIEGTFIENFKISKVTPFDKGGKSW 171 Query: 276 TPLTIDLFQYFLR*VKSLKKLF 341 TPLTID FQ+ +K L+ L+ Sbjct: 172 TPLTIDRFQHSRHLLKFLRNLY 193 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 44.8 bits (101), Expect = 7e-05 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P+NYRPIS+ K E I+L+ L +H N+L N Q GF +G S Sbjct: 846 PANYRPISLTCLCCKTMEHIVLSHLNKHLSRFNILSNAQHGFRQGLS 892 >SB_41708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 507 Score = 44.8 bits (101), Expect = 7e-05 Identities = 21/66 (31%), Positives = 39/66 (59%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPI+VLP + K+FEK+I +Q+ E F+ + ++ + + TT + N+ + Sbjct: 155 NYRPITVLPCVDKVFEKLICSQVAEGFERHFFTNSSAYRKSHSCETT------LINLIEG 208 Query: 464 WEESHD 481 W+++ D Sbjct: 209 WKKARD 214 >SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2124 Score = 44.8 bits (101), Expect = 7e-05 Identities = 29/79 (36%), Positives = 41/79 (51%), Gaps = 1/79 (1%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 PSNYRPIS+ K+ E I+L+ L +H + N+L + Q GF G S + L + + Sbjct: 1852 PSNYRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGFRSGFS-CETQLILATHDW 1910 Query: 458 QSWEESHDCL-GIFCDLSK 511 S SH + I D SK Sbjct: 1911 ASTLNSHGQVDAIMLDFSK 1929 >SB_20189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 44.4 bits (100), Expect = 9e-05 Identities = 23/63 (36%), Positives = 35/63 (55%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +NYRPIS+LP LSKI E+ + QL S+ L+ ++Q GF S A L + + Sbjct: 313 NNYRPISILPILSKILERHVHVQLYAVLNSHQLITHRQSGFRPYHSCETAMIELFDTLLK 372 Query: 461 SWE 469 + + Sbjct: 373 NMD 375 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 + + L GIS K+LK I L I N IK +FP + K ++V P+ Sbjct: 251 IKISKATGLDGISAKLLKLAGPAIDMPLCKIINLSIKQSIFPTIWKQAQVTPV 303 >SB_58610| Best HMM Match : RVT_1 (HMM E-Value=0.061) Length = 1445 Score = 44.4 bits (100), Expect = 9e-05 Identities = 23/63 (36%), Positives = 35/63 (55%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +NYRPIS+LP LSKI E+ + QL S+ L+ ++Q GF S A L + + Sbjct: 327 NNYRPISILPILSKILERHVHVQLYAVLNSHQLITHRQSGFRPYHSCETAMIELFDTLLK 386 Query: 461 SWE 469 + + Sbjct: 387 NMD 389 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 + + L GIS K+LK I L I N IK +FP + K ++V P+ Sbjct: 265 IKISKATGLDGISAKLLKLAGPAIDMPLCKIINLSIKQSIFPTIWKQAQVTPV 317 >SB_28047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 962 Score = 44.4 bits (100), Expect = 9e-05 Identities = 23/79 (29%), Positives = 45/79 (56%), Gaps = 2/79 (2%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKS--NNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 ++ RPIS+LP LSK++E+++L Q+ + S ++ L + + +G STT + + +I Sbjct: 634 NDLRPISILPVLSKVYERLVLGQMSDFVSSGPDSFLKDTVSAYRKGHSTTTSLLAIKDDI 693 Query: 455 FQSWEESHDCLGIFCDLSK 511 ++ + L + D SK Sbjct: 694 TKAMKRGEVTLVVLADFSK 712 Score = 32.7 bits (71), Expect = 0.30 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 126 GISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKV 245 GI VK +K D +AS L I N CI FP K +++ Sbjct: 582 GIPVKFIKHAADHLASPLTHILNTCISQEYFPSACKVARI 621 >SB_21047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.4 bits (100), Expect = 9e-05 Identities = 21/49 (42%), Positives = 30/49 (61%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDA 430 N+RP+S LP +SK+ EK + QL +H SNNL + Q + + ST A Sbjct: 97 NFRPVSNLPMVSKVIEKAVAEQLTKHIVSNNLGVSLQSSYKKFHSTETA 145 >SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) Length = 570 Score = 44.4 bits (100), Expect = 9e-05 Identities = 21/47 (44%), Positives = 27/47 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ K+ E I+L+ L H NN+L + Q GF G S Sbjct: 165 PENYRPISLTCICCKVMEHIVLSHLNSHTAMNNILSDLQHGFRSGFS 211 >SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/47 (42%), Positives = 27/47 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ K+ E ++L+ L H NN+L + Q GF G S Sbjct: 400 PENYRPISLTCICCKVMEHVVLSHLNSHTAMNNILSDLQHGFRSGFS 446 >SB_35188| Best HMM Match : RVT_1 (HMM E-Value=2.3e-25) Length = 467 Score = 44.0 bits (99), Expect = 1e-04 Identities = 25/75 (33%), Positives = 41/75 (54%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 N+RP+S LP +SK+ EK + QL +H SNNL + + + + ST A + +I + Sbjct: 22 NFRPVSNLPMVSKVIEKAVAKQLTKHIVSNNLDVSLKSSYKKFHSTETALIKVQNDILCA 81 Query: 464 WEESHDCLGIFCDLS 508 + + L + DLS Sbjct: 82 IDGGNLVLMLLLDLS 96 >SB_21074| Best HMM Match : NadA (HMM E-Value=2) Length = 358 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/47 (42%), Positives = 27/47 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ K+ E ++L+ L H NN+L + Q GF G S Sbjct: 263 PENYRPISLTCICCKVMEHVVLSHLNSHTAMNNILSDLQHGFRSGFS 309 >SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8) Length = 339 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/47 (42%), Positives = 27/47 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ K+ E ++L+ L H NN+L + Q GF G S Sbjct: 241 PENYRPISLTCICCKVMEHVVLSHLNSHTAMNNILSDLQHGFRSGFS 287 >SB_8909| Best HMM Match : LRR_2 (HMM E-Value=0.34) Length = 568 Score = 44.0 bits (99), Expect = 1e-04 Identities = 25/75 (33%), Positives = 39/75 (52%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 N+RP+S LP + K+ EK + QL +H SNNL + Q + + ST A + +I Sbjct: 417 NFRPVSNLPMVFKVIEKAVAEQLTKHIVSNNLNVSLQSSYKKFHSTETALIKVQNDILCV 476 Query: 464 WEESHDCLGIFCDLS 508 + + L + DLS Sbjct: 477 IDGGNSVLMLLLDLS 491 >SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 181 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/47 (42%), Positives = 27/47 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ K+ E ++L+ L H NN+L + Q GF G S Sbjct: 83 PENYRPISLTCICCKVMEHVVLSHLNSHTAMNNILSDLQHGFRSGFS 129 >SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 402 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/47 (42%), Positives = 27/47 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ K+ E ++L+ L H NN+L + Q GF G S Sbjct: 83 PENYRPISLTCICCKVMEHVVLSHLNSHTAMNNILSDLQHGFRSGFS 129 >SB_26005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/63 (38%), Positives = 34/63 (53%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+ P LSK+ E+ I L E+ S+ LL + Q GF S A LI + + Sbjct: 372 NYRPISISPALSKVIERHIHVCLYEYLNSHKLLSSNQSGFRPYHSCDTALVKLIDYLIGN 431 Query: 464 WEE 472 ++ Sbjct: 432 MDQ 434 >SB_18097| Best HMM Match : NadA (HMM E-Value=2.2) Length = 272 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/47 (42%), Positives = 27/47 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ K+ E ++L+ L H NN+L + Q GF G S Sbjct: 205 PENYRPISLTCICCKVMEHVVLSHLNSHTAMNNILSDLQHGFRSGFS 251 >SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/47 (42%), Positives = 27/47 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ K+ E ++L+ L H NN+L + Q GF G S Sbjct: 117 PENYRPISLTCICCKVMEHVVLSHLNSHTAMNNILSDLQHGFRSGFS 163 >SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) Length = 419 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ KI E I+L+ L +H +NN+L Q GF + S Sbjct: 234 PQNYRPISLTCICCKIMEHIVLSHLNKHLAANNILSIFQHGFRQALS 280 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LNV + GIS +VL+ + ++ L IFN + G P + ++ V+P+ Sbjct: 173 LNVNKSNGPDGISPRVLRDLAKELSGVLCFIFNQSYQEGTLPKIWLNAMVVPV 225 >SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) Length = 330 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ KI E I+L+ L +H +NN+L Q GF + S Sbjct: 95 PQNYRPISLTCICCKIMEHIVLSHLNKHLAANNILSIFQHGFRQALS 141 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LNV + GIS +VL+ + ++ L IFN + G P + ++ V+P+ Sbjct: 34 LNVNKSNGPDGISPRVLRDLAKELSGVLCFIFNQSYQEGTLPKIWLNAMVVPV 86 >SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2396 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ KI E I+L+ L +H +NN+L Q GF + S Sbjct: 1633 PQNYRPISLTCICCKIMEHIVLSHLNKHLAANNILSIFQHGFRQALS 1679 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LNV + GIS +VL+ + ++ L IFN + G P + ++ V+P+ Sbjct: 1572 LNVNKSNGPDGISPRVLRDLAKELSGVLCFIFNQSYQEGTLPKIWLNAMVVPV 1624 >SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 859 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ KI E I+L+ L +H +NN+L Q GF + S Sbjct: 661 PQNYRPISLTCICCKIMEHIVLSHLNKHLAANNILSIFQHGFRQALS 707 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LNV + GIS +VL+ + ++ L IFN + G P + ++ V+P+ Sbjct: 600 LNVNKSNGPDGISPRVLRDLAKELSGVLCFIFNQSYQEGTLPKIWLNAMVVPV 652 >SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2) Length = 329 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ KI E I+L+ L +H +NN+L Q GF + S Sbjct: 216 PQNYRPISLTCICCKIMEHIVLSHLNKHLAANNILSIFQHGFRQALS 262 >SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) Length = 1492 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ KI E I+L+ L +H +NN+L Q GF + S Sbjct: 1071 PQNYRPISLTCICCKIMEHIVLSHLNKHLAANNILSIFQHGFRQALS 1117 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LNV + GIS +VL+ + ++ L IFN + G P + ++ V+P+ Sbjct: 1010 LNVNKSNGPDGISPRVLRDLAKELSGVLCFIFNQSYQEGTLPKIWLNAMVVPV 1062 >SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) Length = 452 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ KI E I+L+ L +H +NN+L Q GF + S Sbjct: 14 PQNYRPISLTCICCKIMEHIVLSHLNKHLAANNILSIFQHGFRQALS 60 >SB_6188| Best HMM Match : Transposase_23 (HMM E-Value=0.41) Length = 531 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/77 (31%), Positives = 38/77 (49%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 SNYRPIS+ KI E I+ L+ H SNN+L + + GF + S ++ + Sbjct: 385 SNYRPISLTSITCKIMEHILFRHLMSHLDSNNILLHIKHGFRKKYSCETQLITVLHELCY 444 Query: 461 SWEESHDCLGIFCDLSK 511 + ++ + I D SK Sbjct: 445 NLDQGNQTDCILLDFSK 461 >SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) Length = 330 Score = 43.6 bits (98), Expect = 2e-04 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ KI E I+L+ L +H +NN+L Q GF + S Sbjct: 95 PQNYRPISLTCICCKIMEHIVLSHLNKHLAANNILSIFQHGFRQALS 141 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LNV + GIS +VL+ + ++ L IFN + G P + ++ V+P+ Sbjct: 34 LNVNKSNGPDGISPRVLRDLAKELSGVLCFIFNQSYQEGTLPKIWLNAMVVPV 86 >SB_46483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 43.2 bits (97), Expect = 2e-04 Identities = 28/79 (35%), Positives = 40/79 (50%), Gaps = 1/79 (1%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRPIS+ K+ E I+L+ L +H + N+L + Q GF G S + L + + Sbjct: 121 PGNYRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGFRSGFS-CETQLILATHDW 179 Query: 458 QSWEESHDCL-GIFCDLSK 511 S SH + I D SK Sbjct: 180 ASTLNSHGQVDAIMLDFSK 198 >SB_33707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/59 (32%), Positives = 34/59 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 P NYR +++L TL K+F I+ +L H +L +Q GF + + T D+ + +K++ Sbjct: 19 PENYRGVTLLSTLGKVFMSIMNERLYNHLTEKGILKTEQCGFRKEQGTIDS-VFALKSL 76 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/42 (40%), Positives = 27/42 (64%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGF 403 P NYRPIS+ K+ E ++L+ L +H ++N++ N Q GF Sbjct: 933 PGNYRPISLTCLACKVMEHVVLSHLNKHLAAHNIISNLQHGF 974 >SB_23472| Best HMM Match : HIT (HMM E-Value=0.43) Length = 168 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTR 409 PSNYRPIS+ KI E II ++ H ++N+L Q GF R Sbjct: 26 PSNYRPISLTAVPCKILEHIIFHDIMNHLDTHNILVKFQHGFRR 69 >SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 411 Score = 43.2 bits (97), Expect = 2e-04 Identities = 28/79 (35%), Positives = 40/79 (50%), Gaps = 1/79 (1%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRPIS+ K+ E I+L+ L +H + N+L + Q GF G S + L + + Sbjct: 70 PGNYRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGFRSGFS-CETQLILATHDW 128 Query: 458 QSWEESHDCL-GIFCDLSK 511 S SH + I D SK Sbjct: 129 ASTLNSHGQVDAIMLDFSK 147 >SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028) Length = 252 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTR 409 PSNYRPIS+ KI E II ++ H ++N+L Q GF R Sbjct: 71 PSNYRPISLTAVPCKILEHIIFHDIMNHLDTHNILVKFQHGFRR 114 >SB_53096| Best HMM Match : PHD (HMM E-Value=0.001) Length = 623 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTR 409 PSNYRPIS+ KI E II ++ H ++N+L Q GF R Sbjct: 555 PSNYRPISLTAVPCKILEHIIFHDIMNHLDTHNILVKFQHGFRR 598 >SB_49562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTR 409 PSNYRPIS+ KI E II ++ H ++N+L Q GF R Sbjct: 160 PSNYRPISLTAVPCKILEHIIFHDIMNHLDTHNILVKFQHGFRR 203 >SB_42434| Best HMM Match : RVT_1 (HMM E-Value=2.7e-18) Length = 418 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/59 (32%), Positives = 34/59 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 P NYR +++L TL K+F I+ +L H +L +Q GF + + T D+ + +K++ Sbjct: 19 PENYRGVTLLSTLGKVFMSIMNERLYNHLTEKGILKTEQCGFRKEQGTIDS-VFALKSL 76 >SB_25064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1134 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTR 409 PSNYRPIS+ KI E II ++ H ++N+L Q GF R Sbjct: 655 PSNYRPISLTAVPCKILEHIIFHDIMNHIDTHNILVKFQHGFRR 698 >SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) Length = 698 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTR 409 PSNYRPIS+ KI E II ++ H ++N+L Q GF R Sbjct: 274 PSNYRPISLTAVPCKILEHIIFHDIMNHLDTHNILVKFQHGFRR 317 >SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 43.2 bits (97), Expect = 2e-04 Identities = 28/79 (35%), Positives = 40/79 (50%), Gaps = 1/79 (1%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRPIS+ K+ E I+L+ L +H + N+L + Q GF G S + L + + Sbjct: 62 PGNYRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGFRSGFS-CETQLILATHDW 120 Query: 458 QSWEESHDCL-GIFCDLSK 511 S SH + I D SK Sbjct: 121 ASTLNSHGQVDAIMLDFSK 139 >SB_12041| Best HMM Match : PHD (HMM E-Value=0.001) Length = 560 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTR 409 PSNYRPIS+ KI E II ++ H ++N+L Q GF R Sbjct: 485 PSNYRPISLTAVPCKILEHIIFHDIMNHLDTHNILVKFQHGFRR 528 >SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 979 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTR 409 PSNYRPIS+ KI E II ++ H ++N+L Q GF R Sbjct: 111 PSNYRPISLTAVPCKILEHIIFHDIMNHLDTHNILVKFQHGFRR 154 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 43.2 bits (97), Expect = 2e-04 Identities = 28/79 (35%), Positives = 40/79 (50%), Gaps = 1/79 (1%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYRPIS+ K+ E I+L+ L +H + N+L + Q GF G S + L + + Sbjct: 201 PGNYRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGFRSGFS-CETQLILATHDW 259 Query: 458 QSWEESHDCL-GIFCDLSK 511 S SH + I D SK Sbjct: 260 ASTLNSHGQVDAIMLDFSK 278 >SB_10707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/48 (41%), Positives = 30/48 (62%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRST 421 P+NYRPIS+ SK+ E II + +++H + +L + Q GF RST Sbjct: 281 PANYRPISLTCIASKVLEHIIHSHVMKHLQHYGILTDVQHGFRAKRST 328 >SB_40407| Best HMM Match : RVT_1 (HMM E-Value=9.4e-33) Length = 290 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/76 (32%), Positives = 35/76 (46%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +N RP+S L SKI E+ + QL H N LL Q + + ST A + +I Sbjct: 66 NNLRPVSNLQFTSKITERAVFNQLYAHVTENVLLPELQSAYRKSHSTETALLKIANDILI 125 Query: 461 SWEESHDCLGIFCDLS 508 + H L + DLS Sbjct: 126 NMNSQHVTLLVLLDLS 141 >SB_26857| Best HMM Match : Viral_NABP (HMM E-Value=2.6) Length = 526 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/76 (27%), Positives = 40/76 (52%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +++RPIS LP +SK EK++ ++ +H L Q + +G ST A + +I + Sbjct: 407 NHFRPISNLPFVSKAMEKVVAIRINQHLDCGGLHEIYQSAYKKGHSTETALTRIQNDILR 466 Query: 461 SWEESHDCLGIFCDLS 508 + ++ + + DLS Sbjct: 467 AIDDGQSVILVLLDLS 482 >SB_24508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 332 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/61 (31%), Positives = 35/61 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P NYR +++L TL K+F I+ +L H +L +Q GF + + T D+ + +K++ Sbjct: 220 PENYRGVTLLSTLDKVFMSIMNKRLYNHLTEKGILITEQCGFRKEQGTIDS-IFALKSLI 278 Query: 458 Q 460 + Sbjct: 279 E 279 >SB_58520| Best HMM Match : RVT_1 (HMM E-Value=0.035) Length = 556 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/76 (27%), Positives = 40/76 (52%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +++RPIS LP +SK EK++ ++ +H L Q + +G ST A + +I + Sbjct: 328 NHFRPISNLPFVSKAMEKVVAIRINQHLDCGGLHEIYQSAYKKGHSTETALTRIQNDILR 387 Query: 461 SWEESHDCLGIFCDLS 508 + ++ + + DLS Sbjct: 388 AIDDGQSVILVLLDLS 403 >SB_57813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/35 (48%), Positives = 26/35 (74%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLL 382 P+NYRPIS L + S+IFEK++ QL+ + + N+L Sbjct: 103 PTNYRPISTLSSFSQIFEKLVYKQLINYIEKFNIL 137 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 + +K +K I+ + SIFN + V PD++K SKV P+ Sbjct: 53 VPIKFIKLANSSISEAITSIFNLSLLQKVVPDILKISKVTPV 94 >SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2529 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ K+ E I+L+ L +H + N+L + Q GF G S Sbjct: 1188 PGNYRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGFRSGFS 1234 Score = 31.5 bits (68), Expect = 0.69 Identities = 18/57 (31%), Positives = 33/57 (57%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 ++RPIS++ SKI K++ +L++ S L+H Q F +G T D +I+++ Sbjct: 544 SWRPISLINVDSKICSKVLCNRLVDTLPS--LIHTDQAAFVKG-ITIDEPIRIIEDV 597 >SB_43483| Best HMM Match : RVT_1 (HMM E-Value=9.4e-33) Length = 919 Score = 42.7 bits (96), Expect = 3e-04 Identities = 25/76 (32%), Positives = 35/76 (46%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +N RP+S L SKI E+ + QL H N LL Q + + ST A + +I Sbjct: 666 NNLRPVSNLQFTSKITERAVFNQLYAHVTENVLLPELQSAYRKSHSTETALLKIANDILI 725 Query: 461 SWEESHDCLGIFCDLS 508 + H L + DLS Sbjct: 726 NMNSQHVTLLVLLDLS 741 >SB_41552| Best HMM Match : RVT_1 (HMM E-Value=5.4e-32) Length = 1241 Score = 42.7 bits (96), Expect = 3e-04 Identities = 24/78 (30%), Positives = 40/78 (51%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIF 457 P+NYR IS+ SK+ E II + +++H + +L + Q GF RST I ++ Sbjct: 515 PANYRHISLTCIASKVLEHIIHSHVMKHLQHYGILTDVQHGFRAKRSTVTQLILTIHDMA 574 Query: 458 QSWEESHDCLGIFCDLSK 511 ++ +E+ D SK Sbjct: 575 KAIQENKSIHAAVLDFSK 592 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ K+ E I+L+ L +H + N+L + Q GF G S Sbjct: 172 PGNYRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGFRSGFS 218 >SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPIS+ K+ E I+L+ L +H + N+L + Q GF G S Sbjct: 140 PGNYRPISLTCLSCKVMEHIVLSHLNKHLSAFNILSDLQHGFRSGFS 186 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/47 (36%), Positives = 28/47 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P+NYRPI++ K+ E I+ + H +++L + Q GF +GRS Sbjct: 238 PANYRPIALTSVTCKVMEHIVYHHIYAHLDRHHILRDFQHGFRKGRS 284 >SB_12628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1163 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/66 (30%), Positives = 38/66 (57%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPI+VLP + +FEK+I +Q+ E F+ + ++ + + TT + N+ + Sbjct: 358 NYRPITVLPCVDTVFEKLICSQVAEGFERHFFTNSSAYRKSHSCETT------LINLIEG 411 Query: 464 WEESHD 481 W+++ D Sbjct: 412 WKKARD 417 Score = 27.9 bits (59), Expect = 8.5 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMK 233 L + A I K+LK +A L S+FN CIK V+P K Sbjct: 295 LKPEKAAGCDAIPPKLLKIGETELAKPLTSLFNSCIKSKVWPGSWK 340 >SB_11213| Best HMM Match : RVT_1 (HMM E-Value=6.4e-38) Length = 510 Score = 42.3 bits (95), Expect = 4e-04 Identities = 18/57 (31%), Positives = 33/57 (57%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKN 451 SNYRPIS+ + KI E I+ + + H +++ +L ++Q F + RS ++I + Sbjct: 114 SNYRPISLTSVICKILEHIVCSHINRHLEAHQILSDRQHAFRKKRSCVTQLCFVIND 170 >SB_6740| Best HMM Match : RVT_1 (HMM E-Value=4.5e-22) Length = 884 Score = 42.3 bits (95), Expect = 4e-04 Identities = 20/66 (30%), Positives = 38/66 (57%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPI+VLP + +FEK+I +Q+ E F+ + ++ + + TT + N+ + Sbjct: 218 NYRPITVLPCVDTVFEKLICSQVAEGFERHFFTNSSAYRKSHSCETT------LINLIEG 271 Query: 464 WEESHD 481 W+++ D Sbjct: 272 WKKARD 277 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 LNV ++ GIS +VL+ + ++ L IFN G P + ++ V P+ Sbjct: 803 LNVSKSSGPDGISPRVLRDLAKELSGMLCFIFNQSYNEGTLPAIWLNAMVDPI 855 Score = 27.9 bits (59), Expect = 8.5 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMK 233 L + A I K+LK +A L S+FN CIK V+P K Sbjct: 155 LKPEKAAGCDAIPPKLLKIGETELAKPLTSLFNSCIKSKVWPGSWK 200 >SB_58198| Best HMM Match : Exo_endo_phos (HMM E-Value=0.012) Length = 816 Score = 41.9 bits (94), Expect = 5e-04 Identities = 32/81 (39%), Positives = 43/81 (53%), Gaps = 4/81 (4%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +NYR +SVL T+ KIFE++ QL + F + N GF RG S A LIK + + Sbjct: 480 TNYRLVSVLSTIPKIFERLQFDQLYDAFAM--VFSNNMSGFLRGHSCCSA---LIK-LTE 533 Query: 461 SWEESHD---CLGIFC-DLSK 511 W S D +G+ DLSK Sbjct: 534 DWRASLDKRESVGVVAIDLSK 554 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +3 Query: 96 LNVKNTADLWGISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHS 239 LN + G+ KV+K+V + L ++FN CI +P+ K S Sbjct: 423 LNTNKSCGPDGLPPKVIKAVATALYKPLTTLFNHCIDSCEWPNDWKRS 470 >SB_46946| Best HMM Match : RVT_1 (HMM E-Value=0.7) Length = 367 Score = 41.9 bits (94), Expect = 5e-04 Identities = 25/76 (32%), Positives = 36/76 (47%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +N RP+S L SKI E+ + QL H N LL Q + + ST A + +I Sbjct: 173 NNLRPVSNLQFTSKITERAVFNQLYAHVTENVLLPELQSAYRKSYSTETALFKIANDILI 232 Query: 461 SWEESHDCLGIFCDLS 508 + + H L + DLS Sbjct: 233 NMKSQHVTLLVLLDLS 248 >SB_8835| Best HMM Match : RVT_1 (HMM E-Value=1.2e-36) Length = 979 Score = 41.9 bits (94), Expect = 5e-04 Identities = 25/76 (32%), Positives = 35/76 (46%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +N RP+S L SKI E+ + QL H N LL Q + + ST A + +I Sbjct: 529 NNLRPVSNLQFTSKITERAVFNQLYAHVTENVLLPELQSAYRKSYSTETALLKIANDILI 588 Query: 461 SWEESHDCLGIFCDLS 508 + H L + DLS Sbjct: 589 NMNSQHVTLLVLLDLS 604 >SB_29292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 717 Score = 41.5 bits (93), Expect = 6e-04 Identities = 19/44 (43%), Positives = 26/44 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTR 409 PSNYRPIS+ KI + II ++ H ++N+L Q GF R Sbjct: 670 PSNYRPISLTAVPCKILKHIIFHDIMNHLDTHNILVKFQHGFRR 713 >SB_2591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 533 Score = 41.1 bits (92), Expect = 9e-04 Identities = 26/77 (33%), Positives = 42/77 (54%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 SNY IS+LP LSK+ EK + QL+ F + + H Q GF G S T ++ +I + Sbjct: 57 SNYSGISLLPILSKVLEKCVARQLVS-FTVDRIYH-LQHGFREGLSCTTQLLAVLHDIGK 114 Query: 461 SWEESHDCLGIFCDLSK 511 + + + I+ DL++ Sbjct: 115 TLDRGVETDVIYLDLTR 131 >SB_799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 41.1 bits (92), Expect = 9e-04 Identities = 19/49 (38%), Positives = 28/49 (57%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDA 430 NYRPISV+P ++K+FE+I+ + ++ L Q GF ST A Sbjct: 288 NYRPISVIPIVAKVFERIVYELFYAFLEKHDFLCKNQSGFRSIHSTMTA 336 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 IS + ++ +D+I + IFN I G+ PD K+++V PL Sbjct: 236 ISARFVRECVDLIFVPISHIFNRSISQGIVPDEWKYARVTPL 277 >SB_58999| Best HMM Match : Exo_endo_phos (HMM E-Value=2.6) Length = 509 Score = 41.1 bits (92), Expect = 9e-04 Identities = 15/47 (31%), Positives = 28/47 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRP+S+ +S++ E ++ + H +N ++ + Q GF +G S Sbjct: 418 PKNYRPVSLTSLISQVMEHVVCKHVTNHLCANQIITHLQHGFQQGLS 464 >SB_54393| Best HMM Match : RNA_pol_Rpc34 (HMM E-Value=9.3e-10) Length = 252 Score = 41.1 bits (92), Expect = 9e-04 Identities = 23/76 (30%), Positives = 39/76 (51%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +SKI E+ + ++ E + + L+ Q GF GRS ++ I Sbjct: 142 NYRPISLLSVVSKIMERCVFNKIRE--RVHCLIQRYQHGFIAGRSCVTQLVEVLDTIGSH 199 Query: 464 WEESHDCLGIFCDLSK 511 + + ++ D+SK Sbjct: 200 LDNGNQIDVVYLDMSK 215 >SB_41382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 41.1 bits (92), Expect = 9e-04 Identities = 20/46 (43%), Positives = 29/46 (63%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRST 421 ++R ISVLP LSKIFEK+I Q+ ++ L + F +G+ST Sbjct: 58 HFRTISVLPVLSKIFEKLIAKQMTNFCVEHSTLRDTVSDFRKGQST 103 >SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4700 Score = 41.1 bits (92), Expect = 9e-04 Identities = 22/65 (33%), Positives = 35/65 (53%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +N RPIS+LP LSKI E+ QL S+ L+ ++Q GF S A L+ + + Sbjct: 390 NNNRPISILPILSKILERHFHVQLYAFLYSHQLITHRQSGFRPYHSCETAMIELVDTLLK 449 Query: 461 SWEES 475 + + + Sbjct: 450 NMDNN 454 >SB_3422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1270 Score = 41.1 bits (92), Expect = 9e-04 Identities = 22/65 (33%), Positives = 40/65 (61%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +NYR I++L +LSKIF I+ +L + + NN++ +Q GF + TTD +++K + Sbjct: 760 NNYRGITLLLSLSKIFASIL--RLYFYLEMNNVMPKEQGGFRKKNGTTD-NIFVLKTLID 816 Query: 461 SWEES 475 + +S Sbjct: 817 KYVKS 821 >SB_53252| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 366 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/76 (30%), Positives = 39/76 (51%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +SKI E+ + ++ E + + L+ Q GF GRS ++ I Sbjct: 50 NYRPISLLSVVSKIMERCVFNKIRE--RVHCLIQRCQHGFIAGRSCVTQLVEVLDTIGSH 107 Query: 464 WEESHDCLGIFCDLSK 511 + + ++ D+SK Sbjct: 108 LDNGNQIDVVYLDMSK 123 Score = 32.3 bits (70), Expect = 0.40 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 141 VLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 +LK +IA L IFN IK G FP K + ++P+ Sbjct: 2 LLKETAAVIAPSLCQIFNKSIKLGKFPSEWKIAHIVPV 39 >SB_33763| Best HMM Match : RVT_1 (HMM E-Value=3.1e-17) Length = 271 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/76 (32%), Positives = 34/76 (44%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +N RP S L SKI E+ + QL H N LL Q + + ST A + +I Sbjct: 34 NNLRPFSNLQFTSKITERAVFNQLYAHVTENVLLPELQSAYRKSYSTETALLKIANDILI 93 Query: 461 SWEESHDCLGIFCDLS 508 + H L + DLS Sbjct: 94 NMNSQHVTLLVLLDLS 109 >SB_11322| Best HMM Match : Pkinase_C (HMM E-Value=4.1) Length = 236 Score = 40.7 bits (91), Expect = 0.001 Identities = 25/76 (32%), Positives = 35/76 (46%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +N RP+S L SKI E+ + QL H N LL Q + + ST A +I Sbjct: 64 TNLRPVSNLQFTSKITERAVFNQLYAHITENVLLPELQSAYRKSYSTETALLKNANDILI 123 Query: 461 SWEESHDCLGIFCDLS 508 + +H L + DLS Sbjct: 124 NMNSTHVTLLVLLDLS 139 >SB_10854| Best HMM Match : Hormone_4 (HMM E-Value=8.4) Length = 217 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/76 (30%), Positives = 39/76 (51%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +SKI E+ + ++ E + + L+ Q GF GRS ++ I Sbjct: 140 NYRPISLLSVVSKIMERCVFNKIRE--RVHCLIQRCQHGFIAGRSCVTQLVEVLDTIGSH 197 Query: 464 WEESHDCLGIFCDLSK 511 + + ++ D+SK Sbjct: 198 LDNGNQIDVVYLDMSK 213 Score = 35.9 bits (79), Expect = 0.032 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 I V++LK +IA L IFN IK G FP K + ++P+ Sbjct: 88 IPVRLLKETAAVIAPSLCQIFNKSIKLGKFPSEWKIAHIVPV 129 >SB_39518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 40.7 bits (91), Expect = 0.001 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 7/99 (7%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L LSK+ E+ + + + ++ Q GF +G+ST + +I Sbjct: 99 NYRPISLLCILSKVLERCVFKRCFNFISPH--IYQLQHGFLKGKSTVTQLVEVYHDIVDR 156 Query: 464 WEESHDCLGIFCDLSK-------HLTVLNMKHGEETTSL 559 D I DLSK HL + ++ E T SL Sbjct: 157 LAGGQDIDVIHLDLSKAFDKVSHHLLISKLQQYEVTGSL 195 >SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1410 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/76 (30%), Positives = 39/76 (51%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +SKI E+ + ++ E + + L+ Q GF GRS ++ I Sbjct: 493 NYRPISLLSVVSKIMERCVFNKIRE--RVHCLIQRCQHGFIAGRSCVTQLVEVLDTIGSH 550 Query: 464 WEESHDCLGIFCDLSK 511 + + ++ D+SK Sbjct: 551 LDNGNQIDVVYLDMSK 566 Score = 35.9 bits (79), Expect = 0.032 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 I V++LK +IA L IFN IK G FP K + ++P+ Sbjct: 441 IPVRLLKETAAVIAPSLCQIFNKSIKLGKFPSEWKIAHIVPV 482 >SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 689 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/47 (36%), Positives = 27/47 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P NYRPI++ K+ E I+ + H +++L + Q GF +GRS Sbjct: 306 PVNYRPIALTSVTCKVMEHIVYHYIYAHLDRHHILRDFQHGFRKGRS 352 >SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 968 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/76 (30%), Positives = 39/76 (51%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +SKI E+ + ++ E + + L+ Q GF GRS ++ I Sbjct: 538 NYRPISLLSVVSKIMERCVFNKIRE--RVHCLIQRCQHGFIAGRSCVTQLVEVLDTIGSH 595 Query: 464 WEESHDCLGIFCDLSK 511 + + ++ D+SK Sbjct: 596 LDNGNQIDVVYLDMSK 611 Score = 35.9 bits (79), Expect = 0.032 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 I V++LK +IA L IFN IK G FP K + ++P+ Sbjct: 486 IPVRLLKETAAVIAPSLCQIFNKSIKLGKFPSEWKIAHIVPV 527 >SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1821 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/76 (30%), Positives = 39/76 (51%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +SKI E+ + ++ E + + L+ Q GF GRS ++ I Sbjct: 441 NYRPISLLSVVSKIMERCVFNKIRE--RVHCLIQRCQHGFIAGRSCVTQLVEVLDTIGSH 498 Query: 464 WEESHDCLGIFCDLSK 511 + + ++ D+SK Sbjct: 499 LDNGNQIDVVYLDMSK 514 Score = 35.9 bits (79), Expect = 0.032 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +3 Query: 129 ISVKVLKSVIDIIASHLVSIFNDCIKCGVFPDLMKHSKVIPL 254 I V++LK +IA L IFN IK G FP K + ++P+ Sbjct: 389 IPVRLLKETAAVIAPSLCQIFNKSIKLGKFPSEWKIAHIVPV 430 >SB_19684| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 617 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/76 (30%), Positives = 39/76 (51%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPIS+L +SKI E+ + ++ E + + L+ Q GF GRS ++ I Sbjct: 301 NYRPISLLSVVSKIMERCVFNKIRE--RVHCLIQRCQHGFIAGRSCVTQLVEVLDTIGSH 358 Query: 464 WEESHDCLGIFCDLSK 511 + + ++ D+SK Sbjct: 359 LDNGNQIDVVYLDMSK 374 >SB_50861| Best HMM Match : Borrelia_orfA (HMM E-Value=4.4) Length = 373 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/48 (33%), Positives = 29/48 (60%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRST 421 P+NYRP+S+ KI E +I + +H + + +L + Q GF + R++ Sbjct: 259 PNNYRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGFRKRRNS 306 >SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1858 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/58 (32%), Positives = 35/58 (60%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 +NYR I++L LSK+F I+ ++L ++ L +Q GF + ST D+ +++K + Sbjct: 1345 NNYRGITLLSCLSKLFTSILNSRLYDYLVQKGYLKKEQGGFRKKHSTVDS-IFILKTV 1401 Score = 36.3 bits (80), Expect = 0.024 Identities = 20/75 (26%), Positives = 34/75 (45%) Frame = +2 Query: 284 NYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQS 463 NYRPI+ + LSK E++ Q + + N LL Q + ST + +I + Sbjct: 64 NYRPITNVAFLSKTLERVAANQTMNYLIPNGLLAKLQSAYRHFHSTETVLLRVFNDILTA 123 Query: 464 WEESHDCLGIFCDLS 508 + + + + DLS Sbjct: 124 IDRQQEVVLVLLDLS 138 >SB_35755| Best HMM Match : RVT_1 (HMM E-Value=1.90001e-40) Length = 414 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDA 430 P NYR +++L TL K+F I+ +L + +L +Q GF + + T D+ Sbjct: 19 PENYRGVTLLSTLGKVFMSIMNERLYNYLTEKGILKTEQCGFRKEQGTIDS 69 >SB_35248| Best HMM Match : DUF999 (HMM E-Value=2.7) Length = 189 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDA 430 P NYR +++L TL K+F I+ +L + +L +Q GF + + T D+ Sbjct: 19 PENYRGVTLLSTLGKVFMSIMNERLYNYLTEKGILKTEQCGFRKEQGTIDS 69 >SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 668 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/47 (36%), Positives = 28/47 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P+NYRP+S+ KI E II + +H + + +L + Q GF + R+ Sbjct: 233 PNNYRPVSLTSVTCKILEHIICHHVWQHLEQHGILSDFQHGFRKRRN 279 >SB_8718| Best HMM Match : Lipase_GDSL (HMM E-Value=0.023) Length = 836 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/58 (32%), Positives = 35/58 (60%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 +NYR I++L LSK+F I+ ++L ++ L +Q GF + ST D+ +++K + Sbjct: 702 NNYRGITLLSCLSKLFTSILNSRLYDYLVQKGYLKKEQGGFRKKHSTVDS-IFILKTV 758 >SB_47325| Best HMM Match : RVT_1 (HMM E-Value=2.2e-31) Length = 300 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/51 (33%), Positives = 29/51 (56%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDA 430 P NYR +++L TL K+F I+ +L + +L +Q GF + + T D+ Sbjct: 19 PENYRGVTLLSTLGKVFMSIMNERLYNYLTEKGILKTEQCGFRKEQGTIDS 69 >SB_40728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1317 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/58 (32%), Positives = 35/58 (60%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 +NYR I++L LSK+F I+ ++L ++ L +Q GF + ST D+ +++K + Sbjct: 1065 NNYRGITLLSCLSKLFTSILNSRLYDYLVQKGYLKKEQGGFRKKHSTVDS-IFILKTV 1121 >SB_27722| Best HMM Match : RVT_1 (HMM E-Value=0.00011) Length = 315 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/58 (32%), Positives = 35/58 (60%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 +NYR I++L LSK+F I+ ++L ++ L +Q GF + ST D+ +++K + Sbjct: 101 NNYRGITLLSCLSKLFTSILNSRLYDYLVQKGYLKKEQGGFRKKHSTVDS-IFILKTV 157 >SB_26566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1141 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/58 (32%), Positives = 35/58 (60%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 +NYR I++L LSK+F I+ ++L ++ L +Q GF + ST D+ +++K + Sbjct: 328 NNYRGITLLSCLSKLFTSILNSRLYDYLVQKGYLKKEQGGFRKKHSTVDS-IFILKTV 384 >SB_22389| Best HMM Match : RVT_1 (HMM E-Value=1.6e-37) Length = 458 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/58 (32%), Positives = 35/58 (60%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNI 454 +NYR I++L LSK+F I+ ++L ++ L +Q GF + ST D+ +++K + Sbjct: 101 NNYRGITLLSCLSKLFTSILNSRLYDYLVQKGYLKKEQGGFRKKHSTVDS-IFILKTV 157 >SB_15883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 438 Score = 40.3 bits (90), Expect = 0.001 Identities = 25/76 (32%), Positives = 34/76 (44%) Frame = +2 Query: 281 SNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRSTTDAGAYLIKNIFQ 460 +N RP+S L SKI E+ + QL H N LL Q + + ST A +I Sbjct: 64 TNLRPVSNLQFTSKITERAVFNQLYAHITENVLLPELQSAYRKSYSTETALLKNANDILI 123 Query: 461 SWEESHDCLGIFCDLS 508 + H L + DLS Sbjct: 124 NMNSQHVTLLVLLDLS 139 >SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) Length = 565 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P+NYRP+S+ KI E +I + +H + + +L + Q GF + R+ Sbjct: 130 PNNYRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGFRKRRN 176 >SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 670 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P+NYRP+S+ KI E +I + +H + + +L + Q GF + R+ Sbjct: 130 PNNYRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGFRKRRN 176 >SB_51085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1251 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P+NYRPI++ K+ E I+ + H +++L + Q F +GRS Sbjct: 704 PANYRPIALTSVTCKVMEHIVYYHIYAHLDRHHILRDFQHAFRKGRS 750 >SB_42960| Best HMM Match : RVT_1 (HMM E-Value=2.38221e-44) Length = 455 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +2 Query: 278 PSNYRPISVLPTLSKIFEKIILTQLLEHFKSNNLLHNKQFGFTRGRS 418 P+NYRP+S+ KI E +I + +H + + +L + Q GF + R+ Sbjct: 20 PNNYRPVSLTSVTCKILEHVICHHVWQHLEQHGILSDFQHGFCKRRN 66 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,074,754 Number of Sequences: 59808 Number of extensions: 417352 Number of successful extensions: 1689 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1675 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -