Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0635
         (570 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory recept...    24   1.0  
AM292366-1|CAL23178.2|  379|Tribolium castaneum gustatory recept...    22   4.2  
AM292329-1|CAL23141.2|  379|Tribolium castaneum gustatory recept...    22   4.2  

>AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory receptor
           candidate 48 protein.
          Length = 408

 Score = 23.8 bits (49), Expect = 1.0
 Identities = 11/32 (34%), Positives = 17/32 (53%), Gaps = 2/32 (6%)
 Frame = +3

Query: 156 HFHEFNYNYKKTTRTVYIVSTQ--FKLLYFKY 245
           + +  NYN+K++ R  Y+   Q  F   YF Y
Sbjct: 121 NLYTINYNFKESERNDYVSLLQLVFVFCYFIY 152


>AM292366-1|CAL23178.2|  379|Tribolium castaneum gustatory receptor
           candidate 45 protein.
          Length = 379

 Score = 21.8 bits (44), Expect = 4.2
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -2

Query: 428 YARHDYYRKL 399
           Y RH YYR+L
Sbjct: 63  YVRHTYYRRL 72


>AM292329-1|CAL23141.2|  379|Tribolium castaneum gustatory receptor
           candidate 8 protein.
          Length = 379

 Score = 21.8 bits (44), Expect = 4.2
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = -2

Query: 428 YARHDYYRKL 399
           Y RH YYR+L
Sbjct: 63  YVRHTYYRRL 72


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 107,726
Number of Sequences: 336
Number of extensions: 2004
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 14099535
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)