BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0630 (708 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51866| Best HMM Match : Pkinase (HMM E-Value=0) 105 4e-23 SB_45091| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 2e-18 SB_20713| Best HMM Match : Pkinase (HMM E-Value=0) 57 1e-08 SB_16420| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_5853| Best HMM Match : Pkinase (HMM E-Value=3.6e-05) 55 5e-08 SB_8354| Best HMM Match : Pkinase (HMM E-Value=6.3e-15) 54 1e-07 SB_10682| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) 53 3e-07 SB_54290| Best HMM Match : Pkinase (HMM E-Value=1.3e-26) 50 1e-06 SB_34303| Best HMM Match : Pkinase (HMM E-Value=0) 45 7e-05 SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_12792| Best HMM Match : Pkinase (HMM E-Value=1.1e-09) 40 0.001 SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_3002| Best HMM Match : Pkinase (HMM E-Value=4.1e-17) 40 0.002 SB_47579| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_27678| Best HMM Match : Pkinase (HMM E-Value=0) 40 0.003 SB_14894| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_35913| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 39 0.005 SB_34306| Best HMM Match : Pkinase (HMM E-Value=0) 39 0.005 SB_37572| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 39 0.005 SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) 38 0.006 SB_21129| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) 38 0.006 SB_33829| Best HMM Match : Pkinase (HMM E-Value=0) 38 0.006 SB_32748| Best HMM Match : Pkinase (HMM E-Value=7.8e-26) 38 0.006 SB_13922| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.008 SB_11825| Best HMM Match : Pkinase (HMM E-Value=1.2e-17) 38 0.008 SB_11460| Best HMM Match : Pkinase (HMM E-Value=0) 38 0.008 SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) 38 0.011 SB_3250| Best HMM Match : Pkinase (HMM E-Value=1e-09) 37 0.014 SB_58868| Best HMM Match : Pkinase (HMM E-Value=1.9e-32) 37 0.014 SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) 37 0.014 SB_25257| Best HMM Match : Pkinase (HMM E-Value=4e-10) 37 0.014 SB_33663| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_21166| Best HMM Match : Pkinase (HMM E-Value=0) 37 0.018 SB_13192| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.018 SB_54907| Best HMM Match : Pkinase (HMM E-Value=1.4e-10) 36 0.024 SB_44532| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_22496| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_1621| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_57581| Best HMM Match : Pkinase (HMM E-Value=4.7e-24) 36 0.024 SB_51685| Best HMM Match : Pkinase (HMM E-Value=0) 36 0.024 SB_43870| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 36 0.024 SB_33662| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_6977| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.024 SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) 36 0.032 SB_41626| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) 36 0.032 SB_33664| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_23401| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.032 SB_33732| Best HMM Match : Pkinase (HMM E-Value=9e-10) 36 0.043 SB_36849| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_33962| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) 36 0.043 SB_11148| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 36 0.043 SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.056 SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.056 SB_36983| Best HMM Match : Pkinase (HMM E-Value=6.4e-22) 35 0.056 SB_28361| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 35 0.056 SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.056 SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.074 SB_19037| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.074 SB_8553| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.074 SB_42528| Best HMM Match : Pkinase (HMM E-Value=1.3e-13) 35 0.074 SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) 35 0.074 SB_18517| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.074 SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.074 SB_45| Best HMM Match : Pkinase (HMM E-Value=0) 35 0.074 SB_42485| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 34 0.098 SB_57461| Best HMM Match : Pkinase (HMM E-Value=1.1e-34) 34 0.098 SB_55336| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.098 SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) 34 0.098 SB_42486| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 34 0.098 SB_38378| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 34 0.098 SB_28925| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 34 0.098 SB_26266| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 34 0.098 SB_41851| Best HMM Match : Pkinase (HMM E-Value=0) 34 0.13 SB_14773| Best HMM Match : Pkinase (HMM E-Value=1.1e-05) 34 0.13 SB_49877| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_37321| Best HMM Match : Pkinase (HMM E-Value=2.4e-27) 34 0.13 SB_26202| Best HMM Match : Pkinase (HMM E-Value=0.0017) 34 0.13 SB_24824| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.32) 34 0.13 SB_55598| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) 33 0.17 SB_22843| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_18146| Best HMM Match : Pkinase (HMM E-Value=0) 33 0.17 SB_40655| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_18299| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_53036| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_42680| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 33 0.23 SB_17930| Best HMM Match : Pkinase (HMM E-Value=0) 33 0.23 SB_11943| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 33 0.23 SB_10926| Best HMM Match : Pkinase (HMM E-Value=3e-24) 33 0.23 SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) 33 0.23 SB_1550| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 33 0.23 SB_30884| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.8e-33) 33 0.23 SB_22527| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_32519| Best HMM Match : Pkinase (HMM E-Value=7.3e-39) 33 0.30 SB_29640| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_22883| Best HMM Match : Pkinase (HMM E-Value=6.4e-12) 33 0.30 SB_31810| Best HMM Match : Pkinase (HMM E-Value=0.17) 33 0.30 SB_58677| Best HMM Match : Pkinase (HMM E-Value=2.8e-33) 32 0.40 SB_31696| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_22670| Best HMM Match : Pkinase (HMM E-Value=0) 32 0.40 SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_45888| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.4e-25) 32 0.40 SB_24478| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_12392| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_5779| Best HMM Match : Pkinase (HMM E-Value=1.8e-19) 32 0.40 SB_35436| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.52 SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.52 SB_14304| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.52 SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) 32 0.52 SB_13067| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.52 SB_34104| Best HMM Match : SH2 (HMM E-Value=1.6e-24) 31 0.69 SB_31555| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 31 0.69 SB_18047| Best HMM Match : Pkinase (HMM E-Value=2.1e-07) 31 0.69 SB_51259| Best HMM Match : Pkinase_Tyr (HMM E-Value=3.4e-08) 31 0.69 SB_34086| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.69 SB_28695| Best HMM Match : Ras (HMM E-Value=0) 31 0.69 SB_25669| Best HMM Match : LRR_1 (HMM E-Value=9.1e-33) 31 0.69 SB_36661| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_34401| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 31 0.92 SB_16900| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_42333| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_40820| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 31 0.92 SB_23777| Best HMM Match : Pkinase (HMM E-Value=0.065) 31 0.92 SB_17071| Best HMM Match : Pkinase (HMM E-Value=0.065) 31 0.92 SB_6592| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_3739| Best HMM Match : Pkinase (HMM E-Value=0) 31 0.92 SB_53116| Best HMM Match : Pkinase (HMM E-Value=1.9e-09) 31 1.2 SB_41076| Best HMM Match : Ras (HMM E-Value=1.90016e-42) 31 1.2 SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_10993| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.3e-38) 31 1.2 SB_50960| Best HMM Match : Pkinase (HMM E-Value=0) 31 1.2 SB_23137| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 31 1.2 SB_18879| Best HMM Match : Pkinase_Tyr (HMM E-Value=7e-36) 31 1.2 SB_16221| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_2079| Best HMM Match : Pkinase (HMM E-Value=4.2e-10) 31 1.2 SB_53713| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_37607| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.3e-23) 30 1.6 SB_33716| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_26337| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.3e-21) 30 1.6 SB_43494| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_23465| Best HMM Match : Pkinase_Tyr (HMM E-Value=3.1e-07) 30 2.1 SB_23400| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_19615| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_43344| Best HMM Match : Pkinase (HMM E-Value=6.9e-08) 30 2.1 SB_9759| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 30 2.1 SB_39694| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 29 2.8 SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_21044| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 29 2.8 SB_34601| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_26833| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_26127| Best HMM Match : Pkinase (HMM E-Value=5.3e-10) 29 3.7 SB_982| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_41623| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_19466| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_7625| Best HMM Match : Pkinase (HMM E-Value=6.8e-10) 29 4.9 SB_54232| Best HMM Match : Pkinase (HMM E-Value=1.1e-39) 28 6.5 SB_51157| Best HMM Match : Pkinase (HMM E-Value=0.00029) 28 6.5 SB_41743| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_26513| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_23902| Best HMM Match : Pkinase (HMM E-Value=2.29813e-43) 28 6.5 SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_13537| Best HMM Match : Pkinase (HMM E-Value=4e-11) 28 6.5 SB_47182| Best HMM Match : Pkinase (HMM E-Value=1e-09) 28 6.5 SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_26437| Best HMM Match : Pkinase (HMM E-Value=3.6e-36) 28 6.5 SB_17544| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_15977| Best HMM Match : Pkinase (HMM E-Value=2e-06) 28 6.5 SB_59022| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.4e-13) 28 8.5 SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) 28 8.5 SB_36782| Best HMM Match : Pkinase (HMM E-Value=1.4e-32) 28 8.5 SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) 28 8.5 SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_18129| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_11623| Best HMM Match : ABC1 (HMM E-Value=0) 28 8.5 SB_51111| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_28889| Best HMM Match : ANF_receptor (HMM E-Value=1.1e-34) 28 8.5 SB_9676| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_5071| Best HMM Match : RIO1 (HMM E-Value=0) 28 8.5 SB_2153| Best HMM Match : Laminin_G_2 (HMM E-Value=0.36) 28 8.5 SB_1165| Best HMM Match : Pkinase (HMM E-Value=5.6e-23) 28 8.5 >SB_51866| Best HMM Match : Pkinase (HMM E-Value=0) Length = 948 Score = 105 bits (252), Expect = 4e-23 Identities = 64/165 (38%), Positives = 91/165 (55%), Gaps = 10/165 (6%) Frame = +3 Query: 237 KVSQTFQSAVHAKRTYRELRMLKHXNHENVIGLLDVFTPEKTLEDFQQVYLVTHLMGADL 416 K+S+ F A+RT+REL++L+H H+N+I + D+ P L++F VY+V LM +DL Sbjct: 53 KISRAFDVLTTARRTHRELKILRHFKHDNIICIRDILKPPVNLDEFDDVYVVLDLMESDL 112 Query: 417 NNIVRT-QKLSDDHVQFLVYQILRGLKYIHSAASFIGI*NPLT*L*MRTVS*KS*ILAW- 590 + I+ T Q L+ +HV++ +YQILRGLKYIHSA P L K Sbjct: 113 HRIIHTDQPLTTEHVRYFLYQILRGLKYIHSAKVLHRDLKPSNLLVNENAELKIGDFGMA 172 Query: 591 ----RDPLRLK*QV--MWATRWYRAPEIMLHWMHYNP--NWWTFG 701 PL K + ATRWYRAPE+ML Y+ + W+ G Sbjct: 173 RGLCSSPLEQKRFMTEYVATRWYRAPELMLSLNEYSEAIDMWSVG 217 Score = 54.4 bits (125), Expect = 9e-08 Identities = 27/67 (40%), Positives = 44/67 (65%), Gaps = 3/67 (4%) Frame = +1 Query: 97 RFHKVEINKTE--WIVPERYQMLTPVGSGAYGQVCSAIDAQHSMKVAIKKLARPFNQL-F 267 R + ++ TE ++V RY+++ +G+GAYG VCSA+D + KVA+KK++R F+ L Sbjct: 4 RSYTIKDKNTEIKFVVDARYKLIETIGNGAYGVVCSAMDTRTGAKVAVKKISRAFDVLTT 63 Query: 268 MQREHTE 288 +R H E Sbjct: 64 ARRTHRE 70 Score = 51.2 bits (117), Expect = 8e-07 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 7/72 (9%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLAR-----PTETE--MTGYVGDKMVSCARDNAPLD 670 ++HRDLKPSN+ VNE+ ELKI DFG+AR P E + MT YV + L+ Sbjct: 146 VLHRDLKPSNLLVNENAELKIGDFGMARGLCSSPLEQKRFMTEYVATRWYRAPELMLSLN 205 Query: 671 AL*PKLVDIWSV 706 + +D+WSV Sbjct: 206 EY-SEAIDMWSV 216 >SB_45091| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 89.4 bits (212), Expect = 2e-18 Identities = 40/86 (46%), Positives = 61/86 (70%) Frame = +3 Query: 237 KVSQTFQSAVHAKRTYRELRMLKHXNHENVIGLLDVFTPEKTLEDFQQVYLVTHLMGADL 416 K+S+ FQ+ HAKR +REL +++ NH+N+IGLL+VFTP++TLE F +YLV LM A L Sbjct: 16 KLSRPFQNVTHAKRAFRELVLMRMVNHKNIIGLLNVFTPDRTLEQFNDLYLVMELMDASL 75 Query: 417 NNIVRTQKLSDDHVQFLVYQILRGLK 494 ++ L + + +L+YQ+L G+K Sbjct: 76 CQVIH-MDLDHERLSYLLYQMLCGVK 100 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 196 SAIDAQHSMKVAIKKLARPFNQL 264 +AID KVAIKKL+RPF + Sbjct: 2 AAIDTVTGEKVAIKKLSRPFQNV 24 >SB_20713| Best HMM Match : Pkinase (HMM E-Value=0) Length = 492 Score = 57.2 bits (132), Expect = 1e-08 Identities = 31/95 (32%), Positives = 53/95 (55%), Gaps = 10/95 (10%) Frame = +3 Query: 255 QSAVHAKRTYRELRMLKHXNHENVIGLLDVFTPE---------KTLEDFQQVYLVTHLMG 407 Q + T R++ + ++ HEN++ LL++ E + +D VYLV +M Sbjct: 48 QDQSSCRTTLRQIEVQRNLEHENIVKLLNIVDCEGKSIHNGDAENFKDTDYVYLVQEVME 107 Query: 408 ADLNNIVRTQK-LSDDHVQFLVYQILRGLKYIHSA 509 +L+ I+++ L D+ + +YQ+LRGLKYIHSA Sbjct: 108 TNLHTILQSNSSLGQDYTKLFLYQLLRGLKYIHSA 142 Score = 36.3 bits (80), Expect = 0.024 Identities = 19/40 (47%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +2 Query: 494 IHTFGGIIHRDLKPSNIAV-NEDCELKILDFGLARPTETE 610 IH+ ++HRD+KPSN+ V +E LKI DFG R + E Sbjct: 139 IHS-ANVLHRDIKPSNLLVDSETLMLKIGDFGQTRVVDPE 177 >SB_16420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 56.4 bits (130), Expect = 2e-08 Identities = 26/57 (45%), Positives = 39/57 (68%) Frame = +3 Query: 324 VIGLLDVFTPEKTLEDFQQVYLVTHLMGADLNNIVRTQKLSDDHVQFLVYQILRGLK 494 +IGLL+VFTP++TLE F +YLV LM A L ++ L + + +L+YQ+L G+K Sbjct: 1 IIGLLNVFTPDRTLEQFNDLYLVMELMDASLCQVIH-MDLDHERLSYLLYQMLCGVK 56 >SB_5853| Best HMM Match : Pkinase (HMM E-Value=3.6e-05) Length = 229 Score = 55.2 bits (127), Expect = 5e-08 Identities = 28/61 (45%), Positives = 39/61 (63%), Gaps = 7/61 (11%) Frame = +1 Query: 94 PRFHKVEINKTEWIVPERYQMLTPVGSGAYGQVCSA-------IDAQHSMKVAIKKLARP 252 P F++ E+ T + VP +YQ L+P+G+GAYGQVCS+ + VAIKKL+RP Sbjct: 6 PGFYRTELVNTVYEVPRKYQELSPIGTGAYGQVCSSTITEPDPTNPDGPNTVAIKKLSRP 65 Query: 253 F 255 F Sbjct: 66 F 66 Score = 49.6 bits (113), Expect = 2e-06 Identities = 20/31 (64%), Positives = 26/31 (83%) Frame = +3 Query: 237 KVSQTFQSAVHAKRTYRELRMLKHXNHENVI 329 K+S+ FQS +HAKRTYREL++L+H HEN I Sbjct: 61 KLSRPFQSTMHAKRTYRELKLLRHMRHENYI 91 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +2 Query: 494 IHTFGGIIHRDLKPSNIAVNEDCELKILDF 583 IH+ G+IHRDLKPSNIAVNEDCELK ++ Sbjct: 91 IHS-AGVIHRDLKPSNIAVNEDCELKARNY 119 >SB_8354| Best HMM Match : Pkinase (HMM E-Value=6.3e-15) Length = 280 Score = 54.0 bits (124), Expect = 1e-07 Identities = 38/92 (41%), Positives = 50/92 (54%), Gaps = 6/92 (6%) Frame = +3 Query: 423 IVRTQKLSDDHVQFLVYQILRGLKYIHSAASFIGI*NPLT*L*MRTVS*K---S*ILAWR 593 +++TQ+LS+DH+ + +YQILRGLKYIHSA P L T K + Sbjct: 4 LLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARIA 63 Query: 594 DPLRLK*QVMW---ATRWYRAPEIMLHWMHYN 680 DP + ATRWYRAPEIML+ Y+ Sbjct: 64 DPDHDHTGFLTEYVATRWYRAPEIMLNSKGYS 95 Score = 50.4 bits (115), Expect = 1e-06 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 6/76 (7%) Frame = +2 Query: 494 IHTFGGIIHRDLKPSNIAVNEDCELKILDFGLAR--PTETEMTGYVGDKMVSCARDNAPL 667 IH+ ++HRDLKPSN+ +N C+LKI DFGLAR + + TG++ + V+ AP Sbjct: 29 IHS-ANVLHRDLKPSNLLLNTTCDLKICDFGLARIADPDHDHTGFL-TEYVATRWYRAPE 86 Query: 668 DAL----*PKLVDIWS 703 L K +DIWS Sbjct: 87 IMLNSKGYSKAIDIWS 102 >SB_10682| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) Length = 165 Score = 52.8 bits (121), Expect = 3e-07 Identities = 41/118 (34%), Positives = 59/118 (50%), Gaps = 1/118 (0%) Frame = +3 Query: 312 NHENVIGLLDVFTPEKTLEDFQQVYLVTHLMGADLNNIV-RTQKLSDDHVQFLVYQILRG 488 +HENV+ L++V + + +YLV M DL+N++ R L D H ++++YQ+L+ Sbjct: 26 DHENVVKLMNVIKADND----KDIYLVFEYMDTDLHNVIKRGNILKDIHKRYIMYQLLKA 81 Query: 489 LKYIHSAASFIGI*NPLT*L*MRTVS*KS*ILAWRDPLRLK*QVMWATRWYRAPEIML 662 K+IHS I L S I L V ATRWYRAPEI+L Sbjct: 82 TKFIHSGNV---IHRDLKICDFGLARSVSNITQEAGDPSLTDYV--ATRWYRAPEILL 134 >SB_54290| Best HMM Match : Pkinase (HMM E-Value=1.3e-26) Length = 239 Score = 50.4 bits (115), Expect = 1e-06 Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 6/79 (7%) Frame = +3 Query: 285 RELRMLKHXNHENVIGLLDVFTPEKTLEDFQQ----VYLVTHLMGADLNNIVRT--QKLS 446 RE+++L+ NH N+I L ++ T + DF++ YLV M DL ++ + L+ Sbjct: 24 REIKILRQLNHPNIINLKEIVTDKPNALDFRKDKGAFYLVFEYMDHDLMGLLESGLVHLT 83 Query: 447 DDHVQFLVYQILRGLKYIH 503 +DH++ + Q+L GL Y H Sbjct: 84 EDHIKSFIRQLLDGLNYCH 102 >SB_34303| Best HMM Match : Pkinase (HMM E-Value=0) Length = 226 Score = 44.8 bits (101), Expect = 7e-05 Identities = 28/71 (39%), Positives = 37/71 (52%) Frame = +2 Query: 494 IHTFGGIIHRDLKPSNIAVNEDCELKILDFGLARPTETEMTGYVGDKMVSCARDNAPLDA 673 +HT I+HRD+KP NI V +D ++KI DFGLAR + M + L + Sbjct: 129 LHTHR-IVHRDIKPQNILVTKDGQVKIADFGLARVYKDAMALTSVVVTLWYRAPEVLLQS 187 Query: 674 L*PKLVDIWSV 706 VDIWSV Sbjct: 188 SYATSVDIWSV 198 Score = 35.5 bits (78), Expect = 0.043 Identities = 40/139 (28%), Positives = 63/139 (45%), Gaps = 11/139 (7%) Frame = +3 Query: 279 TYRELRMLKHXN---HENVIGLLDVF-TPEKTLEDFQQVYLVTHLMGADLNNIVR---TQ 437 T RE+ +LK + H NV+ LLD+F P T + + LV + DL + Sbjct: 50 TIREIALLKQIDNFAHPNVVRLLDIFHIPMLTARE-THLNLVFEHVDQDLAAYLEYCPQP 108 Query: 438 KLSDDHVQFLVYQILRGLKYIHSAASFIGI*NPLT*L*MRTVS*K----S*ILAWRDPLR 605 L + ++ L YQIL G+ ++H+ P L + K ++D + Sbjct: 109 GLGEWKIKDLTYQILNGVDFLHTHRIVHRDIKPQNILVTKDGQVKIADFGLARVYKDAMA 168 Query: 606 LK*QVMWATRWYRAPEIML 662 L V+ T WYRAPE++L Sbjct: 169 LTSVVV--TLWYRAPEVLL 185 >SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1287 Score = 44.0 bits (99), Expect = 1e-04 Identities = 38/136 (27%), Positives = 64/136 (47%), Gaps = 4/136 (2%) Frame = +3 Query: 285 RELRMLKHXNHENVIGLLDVFTPEKTLEDFQQVYLVTHLMGADLNNIV--RTQKLSDDHV 458 RE++ L+ +H N++ L +V + + +Y V M +L ++ R + L + + Sbjct: 15 REVKSLRKLSHTNIVKLKEV------IRENDHLYFVFEYMKENLYQMMKNRDKLLPESVI 68 Query: 459 QFLVYQILRGLKYIHSAASFIGI*NP--LT*L*MRTVS*KS*ILAWRDPLRLK*QVMWAT 632 + ++YQIL+GL +IH F P L V LA R +T Sbjct: 69 RNVIYQILQGLAFIHKHGYFHRDMKPENLLCTGHELVKIADFGLARETRSRPPYTDYVST 128 Query: 633 RWYRAPEIMLHWMHYN 680 RWYRAPE++L +Y+ Sbjct: 129 RWYRAPEVLLRSTNYS 144 Score = 36.7 bits (81), Expect = 0.018 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGLARPTETE--MTGYVGDK 634 G HRD+KP N+ +KI DFGLAR T + T YV + Sbjct: 86 GYFHRDMKPENLLCTGHELVKIADFGLARETRSRPPYTDYVSTR 129 >SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1351 Score = 41.1 bits (92), Expect = 9e-04 Identities = 23/69 (33%), Positives = 38/69 (55%), Gaps = 4/69 (5%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLARPTETEMTGYVGDKMVSCARDNAPLDAL*PKL- 688 ++HRDLKP N+ ++++ +K+ DFGLAR + Y + + R AP L + Sbjct: 89 VLHRDLKPQNLLIDKNGAIKLADFGLARAFGVPVRSYTHEVVTLWYR--APEILLGSRYY 146 Query: 689 ---VDIWSV 706 VD+WS+ Sbjct: 147 ATPVDVWSI 155 Score = 31.9 bits (69), Expect = 0.52 Identities = 41/144 (28%), Positives = 63/144 (43%), Gaps = 9/144 (6%) Frame = +3 Query: 297 MLKHXNHENVIGLLDVFTPEKTLEDFQQVYLVTHLMGADLN---NIVRTQKLSDDHVQFL 467 +++H V LLDV +K+L YLV + DL + + +S ++ Sbjct: 20 LMRHLIMTLVQSLLDVVHNQKSL------YLVFEFLSQDLKKYMDCLPPSGISTSLIKSY 73 Query: 468 VYQILRGLKYIHSAASFIGI*NPLT*L*MRTVS*K----S*ILAWRDPLRLK*QVMWATR 635 VYQ+L G+ Y HS P L + + K A+ P+R + T Sbjct: 74 VYQLLSGVAYCHSHRVLHRDLKPQNLLIDKNGAIKLADFGLARAFGVPVRSYTHEV-VTL 132 Query: 636 WYRAPEIMLHWMHY-NP-NWWTFG 701 WYRAPEI+L +Y P + W+ G Sbjct: 133 WYRAPEILLGSRYYATPVDVWSIG 156 >SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/31 (58%), Positives = 23/31 (74%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLARPTE 604 IIHRDLK N+ +N+D E+K+ DFGLA E Sbjct: 159 IIHRDLKLGNLFLNDDMEVKVGDFGLATRAE 189 >SB_12792| Best HMM Match : Pkinase (HMM E-Value=1.1e-09) Length = 196 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/52 (36%), Positives = 28/52 (53%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGLARPTETEMTGYVGDKMVSCARDNAP 664 GI+H DLKP+N D +LK++DFG+A + + T D + AP Sbjct: 55 GIVHSDLKPANFLF-VDVQLKLIDFGIANAIQGDQTSIQRDTQIGTLNFMAP 105 >SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1184 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/27 (51%), Positives = 21/27 (77%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGL 589 G +HRD+KP NI +++D +K+ DFGL Sbjct: 774 GFVHRDIKPDNILIDKDGHIKLTDFGL 800 >SB_3002| Best HMM Match : Pkinase (HMM E-Value=4.1e-17) Length = 683 Score = 39.9 bits (89), Expect = 0.002 Identities = 15/30 (50%), Positives = 22/30 (73%) Frame = +2 Query: 503 FGGIIHRDLKPSNIAVNEDCELKILDFGLA 592 + ++HRDLKP NI ++E+ +KI DFG A Sbjct: 613 YHNVVHRDLKPENILLDEEINVKISDFGFA 642 >SB_47579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 316 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/30 (50%), Positives = 24/30 (80%) Frame = +2 Query: 506 GGIIHRDLKPSNIAVNEDCELKILDFGLAR 595 G ++HRDLKP+N+ ++ + +K+ DFGLAR Sbjct: 135 GHVLHRDLKPANVFLDANMNVKLGDFGLAR 164 >SB_27678| Best HMM Match : Pkinase (HMM E-Value=0) Length = 641 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 2/79 (2%) Frame = +3 Query: 276 RTYRELRMLKHXNHENVIGLLDVFTPEKTLEDFQQVYLVTHLM--GADLNNIVRTQKLSD 449 R E MLK H N++ D + +T D ++V LVT LM G + R + + + Sbjct: 122 RFREEAEMLKQLQHPNIVKFHDFWESRQTRTDKKRVMLVTELMTSGTLKTYLKRFKGVKE 181 Query: 450 DHVQFLVYQILRGLKYIHS 506 ++ QIL+GL ++H+ Sbjct: 182 KILKSWCRQILKGLHFLHT 200 Score = 29.1 bits (62), Expect = 3.7 Identities = 17/28 (60%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCEL-KILDFGLA 592 IIHRDLK NI +N L KI D GLA Sbjct: 205 IIHRDLKCDNIFINGTTGLVKIGDLGLA 232 >SB_14894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1052 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/32 (59%), Positives = 21/32 (65%) Frame = +2 Query: 500 TFGGIIHRDLKPSNIAVNEDCELKILDFGLAR 595 +F IHRDL NI V ED +KI DFGLAR Sbjct: 866 SFKKCIHRDLAARNILVGEDYVMKIADFGLAR 897 >SB_35913| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1176 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGLAR 595 G++HRDL NI V E+ LKI DFGL+R Sbjct: 1101 GVVHRDLAARNILVGEEKVLKISDFGLSR 1129 >SB_34306| Best HMM Match : Pkinase (HMM E-Value=0) Length = 367 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +2 Query: 437 EAF**PRSVSGIPDFTWTQIHTFG-GIIHRDLKPSNIAVNEDCELKILDFGLARPTETE 610 E F PR++S + G G++HRD+KP+NI D I DFG+A+ E + Sbjct: 101 EVFDLPRALSIVQQVASGLAVVHGKGLVHRDIKPANILFRSDGTAVITDFGVAKEVELD 159 Score = 28.7 bits (61), Expect = 4.9 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +1 Query: 148 YQMLTPVGSGAYGQVCSAIDAQHSMKVAIKKLARPFNQLFMQR 276 YQ+ +G G +V A A KVAIK L +Q F QR Sbjct: 11 YQVHGRLGKGGMAEVYLATQASLQRKVAIKVLLSADDQAFSQR 53 >SB_37572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/33 (48%), Positives = 24/33 (72%) Frame = +2 Query: 494 IHTFGGIIHRDLKPSNIAVNEDCELKILDFGLA 592 +H+ +IHRD+KPSNI V+E K+ DFG++ Sbjct: 144 LHSNLKVIHRDVKPSNILVDERGNFKLCDFGIS 176 >SB_28263| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 1258 Score = 38.7 bits (86), Expect = 0.005 Identities = 15/37 (40%), Positives = 25/37 (67%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLARPTETEMTGY 622 +IHRD+KP N+ +++ LK+ DFG+ ++ TGY Sbjct: 146 VIHRDIKPENLLISKTDILKLCDFGIKISMLSDSTGY 182 >SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1822 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/53 (37%), Positives = 27/53 (50%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGLARPTETEMTGYVGDKMVSCARDNAPL 667 GIIHRDLKP NI ++ +K+ DFGLA + G + +PL Sbjct: 1094 GIIHRDLKPVNIFLDAGGHIKLGDFGLATTHDKTRGGLTAEIHTPSEAQGSPL 1146 >SB_22253| Best HMM Match : Pkinase (HMM E-Value=0) Length = 870 Score = 38.3 bits (85), Expect = 0.006 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 4/69 (5%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLARPTET----EMTGYVGDKMVSCARDNAPLDAL* 679 IIHRD+KP NI V+ +K+ DFG AR + T YV + A + D Sbjct: 66 IIHRDVKPENILVSRSGIVKLCDFGFARTLASGQGEAYTDYVATRWYR-APELLVGDTKY 124 Query: 680 PKLVDIWSV 706 + VD+W+V Sbjct: 125 GRAVDVWAV 133 Score = 36.3 bits (80), Expect = 0.024 Identities = 34/120 (28%), Positives = 56/120 (46%), Gaps = 4/120 (3%) Frame = +3 Query: 315 HENVIGLLDVFTPEKTLEDFQQVYLVTHLMGADLNNIVRTQKLSDDHVQFLVYQILRGLK 494 HEN++ L++VF +K L F V H + DL L ++ V+ +++Q+LR ++ Sbjct: 4 HENLVNLIEVFRRKKRL--FLVFEFVDHTVLDDLERY--PNGLDENTVRKVMWQVLRAIE 59 Query: 495 YIHSAASFIGI*NPLT*L*MRTVS*KS*ILAWRDPLRLK*QVMW----ATRWYRAPEIML 662 +IH P L R+ K + L + ATRWYRAPE+++ Sbjct: 60 FIHRHNIIHRDVKPENILVSRSGIVKLCDFGFARTLASGQGEAYTDYVATRWYRAPELLV 119 >SB_21129| Best HMM Match : Pkinase (HMM E-Value=2.5e-07) Length = 786 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGLA 592 GIIHRDL NI ++ D + KI DFGLA Sbjct: 15 GIIHRDLSLGNILLSSDMDAKIADFGLA 42 >SB_33829| Best HMM Match : Pkinase (HMM E-Value=0) Length = 290 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGLAR 595 G++HRDLK NI +N D + I DFG AR Sbjct: 110 GVVHRDLKCENILLNRDNRILISDFGFAR 138 Score = 37.9 bits (84), Expect = 0.008 Identities = 18/76 (23%), Positives = 42/76 (55%), Gaps = 2/76 (2%) Frame = +3 Query: 285 RELRMLKHXNHENVIGLLDVFTPEKTLEDFQQVYLVTHLM-GADLNNIVRTQ-KLSDDHV 458 RE++++KH NH NV+ L + +E ++Y++ L DL +R+ + ++ Sbjct: 39 REIQVMKHLNHSNVVSL------HEAIETSSRIYIILDLADNGDLLEYIRSNGAIPENEA 92 Query: 459 QFLVYQILRGLKYIHS 506 + +Q++ ++Y+H+ Sbjct: 93 RLFYHQLVDAVEYLHN 108 >SB_32748| Best HMM Match : Pkinase (HMM E-Value=7.8e-26) Length = 187 Score = 38.3 bits (85), Expect = 0.006 Identities = 14/34 (41%), Positives = 25/34 (73%) Frame = +2 Query: 494 IHTFGGIIHRDLKPSNIAVNEDCELKILDFGLAR 595 +H++G I+HRD+KP N+ + +K+ DFGL++ Sbjct: 73 LHSYG-IVHRDIKPDNLLITSLGHIKLTDFGLSK 105 >SB_13922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1012 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/34 (50%), Positives = 24/34 (70%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGLARPTETE 610 G++HRDLKPSNI + D +K+ DFGL T+ + Sbjct: 785 GMMHRDLKPSNIFFSLDGLVKVGDFGLVTATKQD 818 >SB_11825| Best HMM Match : Pkinase (HMM E-Value=1.2e-17) Length = 181 Score = 37.9 bits (84), Expect = 0.008 Identities = 22/98 (22%), Positives = 49/98 (50%), Gaps = 1/98 (1%) Frame = +3 Query: 213 T*YESGY*KVSQTFQSAVHAKRTYRELRMLKHXNHENVIGLLDVFTPEKTLEDFQQVYLV 392 T Y + Y K S S RE+ ++ +H+ ++GLLD + + + V ++ Sbjct: 22 TVYAAKYIKTSGAL-SGSSRDDVMREIDIMSRMHHKRLVGLLDAYDANRNI-----VMIM 75 Query: 393 THLMGADL-NNIVRTQKLSDDHVQFLVYQILRGLKYIH 503 + G +L +V L++ + ++Q+L+G++++H Sbjct: 76 EFISGGELFERVVDEDCLTEKEAAYYMHQLLQGIEHVH 113 Score = 33.1 bits (72), Expect = 0.23 Identities = 15/30 (50%), Positives = 24/30 (80%), Gaps = 2/30 (6%) Frame = +2 Query: 512 IIHRDLKPSNI-AVNEDC-ELKILDFGLAR 595 ++H DLKP NI V++D ++K++DFGLA+ Sbjct: 117 VLHLDLKPENIVCVSKDSWDIKLIDFGLAQ 146 >SB_11460| Best HMM Match : Pkinase (HMM E-Value=0) Length = 323 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/36 (47%), Positives = 23/36 (63%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLARPTETEMTG 619 I+HRDLK N+ +++D + I DFG AR T TG Sbjct: 171 IVHRDLKCENLLLDKDLNIIISDFGFARDCLTTATG 206 >SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) Length = 476 Score = 37.5 bits (83), Expect = 0.011 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Frame = +2 Query: 509 GIIHRDLKPSNIAV---NEDCELKILDFGLARPTETEMTGYVG 628 GI+HRDLKP N+ + +K+ DFGLA + E G+ G Sbjct: 134 GIVHRDLKPENLLLASRERGAMVKLADFGLAIEVDGERLGWYG 176 >SB_3250| Best HMM Match : Pkinase (HMM E-Value=1e-09) Length = 166 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 4/33 (12%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDC----ELKILDFGLAR 595 G++HRDLKPSNI +D L+I+DFG A+ Sbjct: 67 GVVHRDLKPSNIMYADDSGTPESLRIVDFGFAK 99 >SB_58868| Best HMM Match : Pkinase (HMM E-Value=1.9e-32) Length = 434 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 4/33 (12%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDC----ELKILDFGLAR 595 G++HRDLKPSNI +D L+I+DFG A+ Sbjct: 334 GVVHRDLKPSNIMYADDSGTPESLRIVDFGFAK 366 >SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) Length = 428 Score = 37.1 bits (82), Expect = 0.014 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLA 592 ++HRDLKP N+ ++ +KI DFGL+ Sbjct: 151 VVHRDLKPENLLLDSQLNIKIADFGLS 177 >SB_25257| Best HMM Match : Pkinase (HMM E-Value=4e-10) Length = 892 Score = 37.1 bits (82), Expect = 0.014 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 2/40 (5%) Frame = +1 Query: 142 ERYQMLTPVGSGAYGQVCSAIDAQHSMKVAIK--KLARPF 255 +RY++ + +G G++GQVC A D Q +A+K K +PF Sbjct: 386 DRYEIESLIGKGSFGQVCKAYDHQEKEHIAVKIIKNKKPF 425 >SB_33663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGLARPTETEM 613 G +HRDL NI V E+ +K+ DFGL+R E ++ Sbjct: 367 GYLHRDLAARNILVGENNTVKVADFGLSRLIEDDI 401 >SB_21166| Best HMM Match : Pkinase (HMM E-Value=0) Length = 282 Score = 36.7 bits (81), Expect = 0.018 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 8/65 (12%) Frame = +2 Query: 494 IHTFGGIIHRDLKPSNIAVNEDCELKILDFGLAR--------PTETEMTGYVGDKMVSCA 649 IH GI+H DLKP+N+ + +D KI DFG + PT + +TG + Sbjct: 135 IHN-SGIVHLDLKPANVLIADDGSCKIGDFGCCQFVDDQPNTPTRSYLTGTFAYRAPELL 193 Query: 650 RDNAP 664 R +P Sbjct: 194 RGESP 198 >SB_13192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 36.7 bits (81), Expect = 0.018 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLAR 595 I++RDLKP NI ++ D +K+ DFG A+ Sbjct: 160 IVYRDLKPENILLDRDGHVKLTDFGFAK 187 >SB_54907| Best HMM Match : Pkinase (HMM E-Value=1.4e-10) Length = 251 Score = 36.3 bits (80), Expect = 0.024 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = +2 Query: 494 IHTFGGIIHRDLKPSNIAVNEDCELKILDFG 586 IHT G +HRD+KP N+ ++ + LK+ DFG Sbjct: 151 IHTMG-FVHRDVKPDNMLLDGEGHLKLADFG 180 >SB_44532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 36.3 bits (80), Expect = 0.024 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLAR 595 I+HRDLKP N+ ++ +K+ DFGL R Sbjct: 230 ILHRDLKPQNLLIDSKGLIKLADFGLGR 257 >SB_22496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 36.3 bits (80), Expect = 0.024 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLAR 595 +I+RDLKP N+ ++E LK+ DFG A+ Sbjct: 24 LIYRDLKPENLLIDEKGYLKVTDFGFAK 51 >SB_1621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 727 Score = 36.3 bits (80), Expect = 0.024 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 2/75 (2%) Frame = +3 Query: 288 ELRMLKHXNHENVIGLLDVFTPEKTLEDFQQVYLVTHLM--GADLNNIVRTQKLSDDHVQ 461 EL +L+ HE V+ L +VF E +VYLV L G L+ I+ ++ Sbjct: 115 ELAVLRRVKHEFVVRLYEVF------ECKNRVYLVMELATGGVLLDRILSKGFFTERDAT 168 Query: 462 FLVYQILRGLKYIHS 506 ++Y +L G++Y+HS Sbjct: 169 RVIYMVLEGVRYLHS 183 Score = 31.5 bits (68), Expect = 0.69 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +2 Query: 509 GIIHRDLKPSNIAV---NEDCELKILDFGLA 592 GI HRDLKP N+ D ++ I DFGL+ Sbjct: 185 GITHRDLKPENLLYYHPGNDSKIMITDFGLS 215 >SB_57581| Best HMM Match : Pkinase (HMM E-Value=4.7e-24) Length = 235 Score = 36.3 bits (80), Expect = 0.024 Identities = 16/32 (50%), Positives = 24/32 (75%), Gaps = 3/32 (9%) Frame = +2 Query: 509 GIIHRDLKPSNI---AVNEDCELKILDFGLAR 595 GI+HRDLKP N+ + +ED ++ I DFGL++ Sbjct: 129 GIVHRDLKPENLLYYSPDEDSKIMISDFGLSK 160 >SB_51685| Best HMM Match : Pkinase (HMM E-Value=0) Length = 380 Score = 36.3 bits (80), Expect = 0.024 Identities = 17/28 (60%), Positives = 20/28 (71%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLAR 595 I+HRDLK SN+ + LKI DFGLAR Sbjct: 156 IVHRDLKVSNLLLTGKGVLKIADFGLAR 183 Score = 35.5 bits (78), Expect = 0.043 Identities = 20/73 (27%), Positives = 39/73 (53%) Frame = +3 Query: 285 RELRMLKHXNHENVIGLLDVFTPEKTLEDFQQVYLVTHLMGADLNNIVRTQKLSDDHVQF 464 RE+ +L + HEN++ LL+V + F + + + L+N+ + S+ ++ Sbjct: 82 REITLLLNLRHENIVQLLEVVVGKHLDSLFLSMEYCEQDIASLLDNM--SCPFSEAQIKC 139 Query: 465 LVYQILRGLKYIH 503 L+ Q+L G KY+H Sbjct: 140 LMIQLLEGTKYLH 152 >SB_43870| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 869 Score = 36.3 bits (80), Expect = 0.024 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 IHRDL NI V +D LKI DFGLAR Sbjct: 538 IHRDLAARNILVADDNILKIADFGLAR 564 >SB_33662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 36.3 bits (80), Expect = 0.024 Identities = 29/67 (43%), Positives = 33/67 (49%), Gaps = 4/67 (5%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR-PTETEMTGYVGDKMVSCARDNAPLDAL*PKLV 691 IHRDL NI V E +KI DFGL+R E E T G K + AP AL K Sbjct: 360 IHRDLAARNILVGEKNIVKIADFGLSRLIDEGEYTARAGAKFP--IKWTAPEAALYNKFT 417 Query: 692 ---DIWS 703 D+WS Sbjct: 418 IKSDVWS 424 >SB_6977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 36.3 bits (80), Expect = 0.024 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = +2 Query: 494 IHTFGGIIHRDLKPSNIAV---NEDCELKILDFGLARPTETEMTGY 622 I T + HRDLKP N+ + ++ +K+ DFGLA E E TG+ Sbjct: 13 IGTSRWVHHRDLKPENLLLASKEKNAAVKLADFGLAIEVEIEKTGW 58 >SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) Length = 1023 Score = 35.9 bits (79), Expect = 0.032 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLA 592 +IHRD+K N +N + EL++ DFGLA Sbjct: 552 VIHRDIKVGNFFINSNMELRLGDFGLA 578 >SB_41626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 753 Score = 35.9 bits (79), Expect = 0.032 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 IHRDL N+ + +D LK+ DFGLAR Sbjct: 559 IHRDLAARNVLIADDYVLKVADFGLAR 585 >SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) Length = 558 Score = 35.9 bits (79), Expect = 0.032 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +2 Query: 494 IHTFGGIIHRDLKPSNIAVNEDCELKILDFG 586 +HT G +HRD+KP N+ ++ +K+ DFG Sbjct: 196 LHTMG-FVHRDVKPDNVLIDRTGHIKLADFG 225 >SB_33664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 525 Score = 35.9 bits (79), Expect = 0.032 Identities = 17/32 (53%), Positives = 20/32 (62%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLARPTETE 610 IHRDL NI V E+ K+ DFGLAR E + Sbjct: 376 IHRDLAARNILVGENYACKVADFGLARLIEDD 407 >SB_23401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 380 Score = 35.9 bits (79), Expect = 0.032 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 +HRDL N+ V ED KI DFGL+R Sbjct: 216 VHRDLATRNVLVTEDLTAKITDFGLSR 242 >SB_33732| Best HMM Match : Pkinase (HMM E-Value=9e-10) Length = 322 Score = 35.5 bits (78), Expect = 0.043 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFG 586 +IHRD+KP N+ +N ++KI DFG Sbjct: 148 VIHRDIKPENLLLNYKGDIKIADFG 172 >SB_36849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 35.5 bits (78), Expect = 0.043 Identities = 18/37 (48%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +2 Query: 488 TQIHTFGGIIHRDLKPSNIAVN-EDCELKILDFGLAR 595 T IH G I HRD+KP N+ ++ E LK+ DFG A+ Sbjct: 176 TYIHCLG-ICHRDIKPQNLLLDPETAVLKLCDFGSAK 211 >SB_33962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 823 Score = 35.5 bits (78), Expect = 0.043 Identities = 17/27 (62%), Positives = 19/27 (70%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 IHRDL N+ V+E LKI DFGLAR Sbjct: 483 IHRDLAARNVLVDEGYALKIGDFGLAR 509 >SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) Length = 367 Score = 35.5 bits (78), Expect = 0.043 Identities = 16/37 (43%), Positives = 25/37 (67%) Frame = +2 Query: 494 IHTFGGIIHRDLKPSNIAVNEDCELKILDFGLARPTE 604 IH I+HRDLK +NI + +D +K+ DFG+++ E Sbjct: 143 IHN-NNILHRDLKTANIFLTKDTVVKLGDFGISKQLE 178 >SB_11148| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 196 Score = 35.5 bits (78), Expect = 0.043 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 +HRDL N+ V E+ +KI DFGLAR Sbjct: 87 VHRDLAARNVLVGENYVMKIADFGLAR 113 >SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 35.1 bits (77), Expect = 0.056 Identities = 16/29 (55%), Positives = 23/29 (79%), Gaps = 1/29 (3%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCE-LKILDFGLA 592 GI+HRDLK NI ++E + +KI+DFGL+ Sbjct: 136 GIVHRDLKMENILLDESKKTIKIVDFGLS 164 >SB_17500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 35.1 bits (77), Expect = 0.056 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 5/69 (7%) Frame = +2 Query: 512 IIHRDLKPSNI---AVNEDCELKILDFGLAR--PTETEMTGYVGDKMVSCARDNAPLDAL 676 I+HRD+KP N+ + + +K+ DFGLA+ P +T++ L+ Sbjct: 147 IVHRDIKPDNLLLKRIGNNVTIKLADFGLAQALPNDTDVISCGASGAPMFLAPETVLEEP 206 Query: 677 *PKLVDIWS 703 + VDIW+ Sbjct: 207 IGRAVDIWA 215 Score = 30.3 bits (65), Expect = 1.6 Identities = 16/75 (21%), Positives = 37/75 (49%), Gaps = 1/75 (1%) Frame = +3 Query: 285 RELRMLKHXNHENVIGLLDVFTPEKTLEDFQQVYLVTHLMGADL-NNIVRTQKLSDDHVQ 461 +E+ + K HEN++ L +T+ ++ ++ G L + +++ S+ + Sbjct: 75 QEIAVWKDLRHENIVSLYSSIREGETV-----CLIMEYVAGGSLFDEVIQQTYYSEKQAR 129 Query: 462 FLVYQILRGLKYIHS 506 + Q+L L+Y+HS Sbjct: 130 LVTRQLLNALEYLHS 144 >SB_36983| Best HMM Match : Pkinase (HMM E-Value=6.4e-22) Length = 331 Score = 35.1 bits (77), Expect = 0.056 Identities = 19/33 (57%), Positives = 21/33 (63%), Gaps = 4/33 (12%) Frame = +2 Query: 509 GIIHRDLKPSNI-AVNED---CELKILDFGLAR 595 GI+HRDLKP NI V D C K+ DFG AR Sbjct: 132 GIVHRDLKPGNIMRVYRDDGSCVYKLTDFGAAR 164 >SB_28361| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 551 Score = 35.1 bits (77), Expect = 0.056 Identities = 20/47 (42%), Positives = 24/47 (51%) Frame = +2 Query: 455 RSVSGIPDFTWTQIHTFGGIIHRDLKPSNIAVNEDCELKILDFGLAR 595 R G+ D T+ +IHRDL N+ V E KI DFGLAR Sbjct: 423 RKSRGLQD-TYFDDPDLAPVIHRDLAARNVLVGEGQMCKITDFGLAR 468 >SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 35.1 bits (77), Expect = 0.056 Identities = 13/29 (44%), Positives = 22/29 (75%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGLAR 595 GII+RDLK N+ +++D +K+ DFG+ + Sbjct: 406 GIIYRDLKLDNVLLDKDGHIKLADFGMCK 434 >SB_31870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1378 Score = 34.7 bits (76), Expect = 0.074 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFG 586 G+IHRD+K NI + D ++K+ DFG Sbjct: 336 GVIHRDIKSDNILLGMDGQVKLTDFG 361 >SB_19037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.7 bits (76), Expect = 0.074 Identities = 16/32 (50%), Positives = 22/32 (68%), Gaps = 4/32 (12%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDC----ELKILDFGLAR 595 ++HRDLKPSNI +D L+I+DFG A+ Sbjct: 1 VVHRDLKPSNIMYADDSGTPESLRIVDFGFAK 32 >SB_8553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 982 Score = 34.7 bits (76), Expect = 0.074 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 IHRDL N+ V+++ +KI DFGLAR Sbjct: 602 IHRDLAARNVLVSDNHVIKIADFGLAR 628 >SB_42528| Best HMM Match : Pkinase (HMM E-Value=1.3e-13) Length = 255 Score = 34.7 bits (76), Expect = 0.074 Identities = 17/36 (47%), Positives = 24/36 (66%), Gaps = 1/36 (2%) Frame = +2 Query: 524 DLKPSNIAVNEDCELKILDFGLARPTETEM-TGYVG 628 D+KPSNI VN ++K+ DFG++R + T YVG Sbjct: 118 DVKPSNILVNTRGQVKLCDFGVSRQLVNSIATTYVG 153 >SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) Length = 937 Score = 34.7 bits (76), Expect = 0.074 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLA 592 +IHRDLK N+ ++ D +KI DFG + Sbjct: 201 VIHRDLKAENLLLDADMNIKIADFGFS 227 Score = 33.5 bits (73), Expect = 0.17 Identities = 24/100 (24%), Positives = 47/100 (47%), Gaps = 2/100 (2%) Frame = +3 Query: 210 PT*YESGY*KVSQTFQSAVHAKRTYRELRMLKHXNHENVIGLLDVFTPEKTLEDFQQVYL 389 PT E + +T + ++ +RE+R++K +H N++ L +V +KTL YL Sbjct: 104 PTGKEVAIKIIDKTQLNPSSLQKLFREVRIMKFLDHPNIVKLYEVIETDKTL------YL 157 Query: 390 VTHLM--GADLNNIVRTQKLSDDHVQFLVYQILRGLKYIH 503 V G + +V ++ + + QI+ ++Y H Sbjct: 158 VMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCH 197 >SB_18517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 353 Score = 34.7 bits (76), Expect = 0.074 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLARPTE 604 I H DLKPSNI VN K+ DFG + T+ Sbjct: 191 IAHLDLKPSNIIVNSHDVCKLADFGCCQVTD 221 >SB_642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2229 Score = 34.7 bits (76), Expect = 0.074 Identities = 18/38 (47%), Positives = 25/38 (65%), Gaps = 5/38 (13%) Frame = +2 Query: 494 IHTFGGIIHRDLKPSNIAV-----NEDCELKILDFGLA 592 +HT G +I+RDLKP NI V +D +K++DFG A Sbjct: 1630 LHTLG-VIYRDLKPENILVWSLNEGDDLYVKLIDFGTA 1666 >SB_45| Best HMM Match : Pkinase (HMM E-Value=0) Length = 851 Score = 34.7 bits (76), Expect = 0.074 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 3/33 (9%) Frame = +2 Query: 512 IIHRDLKPSNIAV---NEDCELKILDFGLARPT 601 I+HRDLKP+N+ +E LKI DFGL++ T Sbjct: 587 ILHRDLKPNNLLYHFQDETPRLKIADFGLSKDT 619 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/29 (37%), Positives = 21/29 (72%) Frame = +1 Query: 163 PVGSGAYGQVCSAIDAQHSMKVAIKKLAR 249 P+G+G++G V + +D + +VAIK++ R Sbjct: 477 PIGTGSFGCVFAGLDLKDGREVAIKRIER 505 >SB_42485| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1565 Score = 34.3 bits (75), Expect = 0.098 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 +HRDL N+ V D +K+ DFGLAR Sbjct: 1259 VHRDLAARNVLVGPDYVMKVSDFGLAR 1285 >SB_57461| Best HMM Match : Pkinase (HMM E-Value=1.1e-34) Length = 355 Score = 34.3 bits (75), Expect = 0.098 Identities = 13/40 (32%), Positives = 28/40 (70%) Frame = +1 Query: 118 NKTEWIVPERYQMLTPVGSGAYGQVCSAIDAQHSMKVAIK 237 N++E+ V +Y+++ +GSG++G + AI+ + +VA+K Sbjct: 9 NRSEFEVGGKYRLVRKIGSGSFGDIYLAINTTNGEEVAVK 48 Score = 31.1 bits (67), Expect = 0.92 Identities = 15/30 (50%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = +2 Query: 515 IHRDLKPSN--IAVNEDC-ELKILDFGLAR 595 IHRD+KP N + V + C +L ++DFGLA+ Sbjct: 135 IHRDIKPDNFLMGVGKHCNKLFLIDFGLAK 164 >SB_55336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 34.3 bits (75), Expect = 0.098 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLARPTETE 610 IIHRDL NI V E K+ DFG+A+ E Sbjct: 558 IIHRDLAARNILVGEGEVCKVADFGMAKDVSNE 590 >SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) Length = 228 Score = 34.3 bits (75), Expect = 0.098 Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCE-LKILDFGLARPTETEMT 616 IIHRDLK +NI ++++ LK+ DFG+A E +T Sbjct: 50 IIHRDLKGANILLDKEKRFLKLTDFGIAHAVEGVVT 85 >SB_42486| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1554 Score = 34.3 bits (75), Expect = 0.098 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 +HRDL N+ V D +K+ DFGLAR Sbjct: 968 VHRDLAARNVLVGPDYVMKVSDFGLAR 994 >SB_38378| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 478 Score = 34.3 bits (75), Expect = 0.098 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR-PTETEMTGYVGDKM-VSCARDNAPLDAL*PKL 688 IHRDL N + E+ +K+ DFGLAR + E T G K + A L + Sbjct: 329 IHRDLAARNCLIGENRTVKVADFGLARYVIDDEYTASEGTKFPIKWAAPEVILYSKFSSK 388 Query: 689 VDIWS 703 D+W+ Sbjct: 389 SDVWA 393 >SB_28925| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 792 Score = 34.3 bits (75), Expect = 0.098 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 IHRDL NI V+E+ K+ DFGL+R Sbjct: 566 IHRDLAARNILVSENMTTKVSDFGLSR 592 >SB_26266| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1038 Score = 34.3 bits (75), Expect = 0.098 Identities = 16/32 (50%), Positives = 19/32 (59%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLARPTETE 610 IHRDL N + ED LKI DFG++R E Sbjct: 703 IHRDLAARNCLIGEDDVLKISDFGMSREVYDE 734 >SB_41851| Best HMM Match : Pkinase (HMM E-Value=0) Length = 967 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/37 (40%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = +2 Query: 512 IIHRDLKPSNIAVNE-DCELKILDFGLARPTETEMTG 619 ++HRD+K +NI V+ +++I DFG A T++TG Sbjct: 736 VVHRDIKGANILVDSTGQDIRIADFGAAARLATQITG 772 >SB_14773| Best HMM Match : Pkinase (HMM E-Value=1.1e-05) Length = 194 Score = 33.9 bits (74), Expect = 0.13 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +2 Query: 524 DLKPSNIAVNEDCELKILDFGLARPTETE 610 DLKP+N+ ++ LKI DFGLAR E Sbjct: 1 DLKPANLLISSTGHLKIADFGLARVFSNE 29 >SB_49877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 607 Score = 33.9 bits (74), Expect = 0.13 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 4/78 (5%) Frame = +3 Query: 285 RELRMLKHXNHENVIGLLDVFTPEKTLEDFQQVYLVTHLMGADLNNIVRTQ----KLSDD 452 RE +L+ NH NV+ L+ V E + L+T L DL++ ++ KL + Sbjct: 56 RECELLEALNHPNVVRLITVI-----YEGNKPPILITELCDCDLSSFIKDSKSKPKLLLE 110 Query: 453 HVQFLVYQILRGLKYIHS 506 V ++ + GL Y+H+ Sbjct: 111 EVVTIMLDVANGLNYLHT 128 >SB_37321| Best HMM Match : Pkinase (HMM E-Value=2.4e-27) Length = 592 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/30 (53%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = +2 Query: 515 IHRDLKPSNIAVNED---CELKILDFGLAR 595 +H D+KP+NI + D E+KI+DFGLAR Sbjct: 274 VHLDIKPNNILLMTDEIYPEIKIIDFGLAR 303 >SB_26202| Best HMM Match : Pkinase (HMM E-Value=0.0017) Length = 401 Score = 33.9 bits (74), Expect = 0.13 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKI 574 I+HRD+KP N+ VN +C LK+ Sbjct: 163 ILHRDIKPGNLLVNSNCLLKL 183 >SB_24824| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.32) Length = 193 Score = 33.9 bits (74), Expect = 0.13 Identities = 21/51 (41%), Positives = 26/51 (50%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLARPTETEMTGYVGDKMVSCARDNAPL 667 IHRDL N+ V K+ DFGLAR T+ G +VS N+PL Sbjct: 2 IHRDLAARNVLVGLGLVAKVADFGLARHVTTD-----GLYIVSALGPNSPL 47 >SB_55598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 668 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/56 (28%), Positives = 31/56 (55%) Frame = +1 Query: 112 EINKTEWIVPERYQMLTPVGSGAYGQVCSAIDAQHSMKVAIKKLARPFNQLFMQRE 279 E + EW + Y+++ +G G Y +V AI+ + KV + K+ +P + ++RE Sbjct: 377 ESHVIEWGQQDNYELVRKLGRGKYSEVFEAINITNDEKVVV-KILKPVKKKKIKRE 431 Score = 28.3 bits (60), Expect = 6.5 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNED 559 GI+HRD+KP N+ ++ D Sbjct: 481 GIMHRDVKPHNVMIDHD 497 >SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 622 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +2 Query: 509 GIIHRDLKPSNIAV---NEDCELKILDFGLA 592 GIIHRDLKP N+ + +K+ DFG+A Sbjct: 43 GIIHRDLKPHNVLLANRENSAPIKVADFGVA 73 >SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) Length = 759 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/31 (51%), Positives = 21/31 (67%), Gaps = 4/31 (12%) Frame = +2 Query: 512 IIHRDLKPSNIAVNE----DCELKILDFGLA 592 I+HRDLKP N+ V++ LK+ DFGLA Sbjct: 564 IVHRDLKPENLLVHKRSDGQTHLKLADFGLA 594 >SB_22843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1138 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/34 (47%), Positives = 23/34 (67%) Frame = +2 Query: 494 IHTFGGIIHRDLKPSNIAVNEDCELKILDFGLAR 595 IHT G I++ DLKPS + ++ +K+ DF LAR Sbjct: 112 IHTLG-IVYCDLKPSKVLLDGPGNVKLSDFALAR 144 >SB_18146| Best HMM Match : Pkinase (HMM E-Value=0) Length = 888 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/34 (47%), Positives = 23/34 (67%) Frame = +2 Query: 494 IHTFGGIIHRDLKPSNIAVNEDCELKILDFGLAR 595 IHT G I++ DLKPS + ++ +K+ DF LAR Sbjct: 112 IHTLG-IVYCDLKPSKVLLDGPGNVKLSDFALAR 144 >SB_40655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1074 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/31 (51%), Positives = 24/31 (77%), Gaps = 3/31 (9%) Frame = +2 Query: 512 IIHRDLKPSNI---AVNEDCELKILDFGLAR 595 I+H DLKP NI ++N + ++K++DFGLAR Sbjct: 469 IVHLDLKPENIMCESINSN-QIKLVDFGLAR 498 >SB_18299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 33.5 bits (73), Expect = 0.17 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 4/38 (10%) Frame = +2 Query: 512 IIHRDLKPSNIAV----NEDCELKILDFGLARPTETEM 613 I+HRD+KP N+ V N LK+ DFGLA ++ M Sbjct: 137 IVHRDIKPENLLVLNLPNGRKSLKLADFGLAMEVKSPM 174 >SB_53036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 745 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGLARPTE 604 GI H DLKP N+ V + K+ DFG + E Sbjct: 155 GIAHLDLKPGNVLVGANDHCKLADFGCCQAIE 186 >SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 920 Score = 33.1 bits (72), Expect = 0.23 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFG 586 ++HRDLK N+ ++++ +KI DFG Sbjct: 275 VVHRDLKAENLLLDQNMNIKIADFG 299 >SB_42680| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 700 Score = 33.1 bits (72), Expect = 0.23 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGLAR 595 G +HRDL N+ V ++ K+ DFGL R Sbjct: 636 GFVHRDLAARNVLVGDNKVAKVADFGLTR 664 >SB_17930| Best HMM Match : Pkinase (HMM E-Value=0) Length = 286 Score = 33.1 bits (72), Expect = 0.23 Identities = 11/29 (37%), Positives = 21/29 (72%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGLAR 595 G+I+RDLK N+ ++ D +K+ D+G+ + Sbjct: 144 GVIYRDLKLDNVLLDSDGHIKLTDYGMCK 172 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = +3 Query: 312 NHENVIGLLDVFTPEKTLEDFQQVYLVTHLMGADLN-NIVRTQKLSDDHVQFLVYQILRG 488 NH ++GL F L +++ ++ G DL ++ R ++L +DH +F +I Sbjct: 82 NHPFLVGLHSCFQTSSRL-----FFVIEYVSGGDLMYHMQRQRRLPEDHARFYSAEICCA 136 Query: 489 LKYIH 503 L ++H Sbjct: 137 LNFLH 141 >SB_11943| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 591 Score = 33.1 bits (72), Expect = 0.23 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 +HRDL NI + ED +KI DFGL R Sbjct: 527 VHRDLAARNILICEDNLVKISDFGLTR 553 >SB_10926| Best HMM Match : Pkinase (HMM E-Value=3e-24) Length = 1102 Score = 33.1 bits (72), Expect = 0.23 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 5/80 (6%) Frame = +2 Query: 479 FTWTQIHTFG--GIIHRDLKPSNIAVNEDCEL---KILDFGLARPTETEMTGYVGDKMVS 643 F +H F IIHRDL P N+ V ++ K+ DFG A + M+ G+ S Sbjct: 622 FGLNYLHCFKPYSIIHRDLNPGNVMVWRQGDIWRAKLCDFGSAEFVSSRMSVNPGNPFYS 681 Query: 644 CARDNAPLDAL*PKLVDIWS 703 + P PK +D++S Sbjct: 682 APEVDTPKQT--PK-IDVYS 698 >SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) Length = 1850 Score = 33.1 bits (72), Expect = 0.23 Identities = 23/72 (31%), Positives = 34/72 (47%), Gaps = 7/72 (9%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGLARPTETEMTG----YVGDKMVSCARDNAP---L 667 G++HR + PSN+ V ED + G R +++ G YV +K R +AP L Sbjct: 631 GLVHRSICPSNVMVGEDYVCMLSGLGTVRELKSQGEGTTPEYVSNKSTQ-VRHDAPESLL 689 Query: 668 DAL*PKLVDIWS 703 D D+WS Sbjct: 690 DGRFSCASDMWS 701 >SB_1550| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 931 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 IHRDL NI V+++ K+ DFGL+R Sbjct: 693 IHRDLAARNILVSDNLAAKVSDFGLSR 719 >SB_30884| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.8e-33) Length = 308 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 IHRDL NI V+++ K+ DFGL+R Sbjct: 10 IHRDLAARNILVSDNLAAKVSDFGLSR 36 >SB_22527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1048 Score = 33.1 bits (72), Expect = 0.23 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGLAR 595 G +HRDL N+ V ++ K+ DFGL R Sbjct: 751 GFVHRDLAARNVLVGDNKVAKVADFGLTR 779 >SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1616 Score = 32.7 bits (71), Expect = 0.30 Identities = 11/26 (42%), Positives = 21/26 (80%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLA 592 +HRD+K +N+ ++E ++K+ DFG+A Sbjct: 929 LHRDIKAANVLMSETGDVKLADFGVA 954 >SB_32519| Best HMM Match : Pkinase (HMM E-Value=7.3e-39) Length = 1486 Score = 32.7 bits (71), Expect = 0.30 Identities = 15/32 (46%), Positives = 23/32 (71%) Frame = +2 Query: 506 GGIIHRDLKPSNIAVNEDCELKILDFGLARPT 601 GGIIHRDLK N+ ++E+ ++I+ GL + T Sbjct: 299 GGIIHRDLKVENLLLDEEYNIRII--GLLQDT 328 >SB_29640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +1 Query: 145 RYQMLTPVGSGAYGQVCSAIDAQHSMKVAIK 237 RY++L +G G++GQV A+D + VA+K Sbjct: 286 RYEVLEVLGKGSFGQVVKALDHKTGQHVAVK 316 >SB_22883| Best HMM Match : Pkinase (HMM E-Value=6.4e-12) Length = 326 Score = 32.7 bits (71), Expect = 0.30 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +3 Query: 285 RELRMLKHXNHENVIGLLDVFTPEK 359 RE+R+LK NH+NVI L DV E+ Sbjct: 118 REIRLLKRLNHKNVIQLYDVIYDER 142 >SB_31810| Best HMM Match : Pkinase (HMM E-Value=0.17) Length = 152 Score = 32.7 bits (71), Expect = 0.30 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +2 Query: 524 DLKPSNIAVNEDCELKILDFGLAR 595 DLKP NI ++E+ +KI DFG A+ Sbjct: 2 DLKPENILLDENMHIKITDFGTAK 25 >SB_58677| Best HMM Match : Pkinase (HMM E-Value=2.8e-33) Length = 834 Score = 32.3 bits (70), Expect = 0.40 Identities = 11/39 (28%), Positives = 26/39 (66%) Frame = +1 Query: 121 KTEWIVPERYQMLTPVGSGAYGQVCSAIDAQHSMKVAIK 237 K+E+IV +Y+++ +GSG++G + + ++ + A+K Sbjct: 5 KSEFIVQGKYRLVRKIGSGSFGDIYLCVHTENGEEKAVK 43 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 3/30 (10%) Frame = +2 Query: 515 IHRDLKPSN--IAVNEDC-ELKILDFGLAR 595 IHRD+KP N + + C +L ++DFGLA+ Sbjct: 130 IHRDIKPDNFLMGIGRHCNKLYLIDFGLAK 159 >SB_31696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/39 (41%), Positives = 27/39 (69%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLARPTETEMTGYVG 628 I+H D++P+NI V + ++K++DFG AR ++ G VG Sbjct: 165 IVHLDIRPANIMV-QGSDVKLIDFGNARKLKSR-HGEVG 201 >SB_22670| Best HMM Match : Pkinase (HMM E-Value=0) Length = 662 Score = 32.3 bits (70), Expect = 0.40 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLA 592 I HRD+K NI V E+ I DFGLA Sbjct: 495 IAHRDIKSKNILVKENLTCCIADFGLA 521 >SB_19291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 32.3 bits (70), Expect = 0.40 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGL 589 G++H D+KP+N+ D KI DFGL Sbjct: 595 GMVHMDIKPANVFFGHDGLCKIGDFGL 621 >SB_45888| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.4e-25) Length = 561 Score = 32.3 bits (70), Expect = 0.40 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLARPTETE 610 IHRDL N+ V K+ DFGLAR T+ Sbjct: 523 IHRDLAARNVLVGLGLVAKVADFGLARHVTTD 554 >SB_24478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 747 Score = 32.3 bits (70), Expect = 0.40 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGLARPTETEMTGYV 625 G++HRD+K N+ ++ KI D G +P E M+G + Sbjct: 585 GLVHRDIKLKNVLLDSKNRGKITDLGFCKP-EAMMSGSI 622 >SB_12392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 32.3 bits (70), Expect = 0.40 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 512 IIHRDLKPSNIAVNE-DCELKILDFGLARPTETEMTGYVGD 631 I HRDLKP NI +++ +K+ DFGL+ Y D Sbjct: 187 ISHRDLKPDNILLDKRSMRIKLADFGLSHQVAVTTKYYQDD 227 >SB_5779| Best HMM Match : Pkinase (HMM E-Value=1.8e-19) Length = 284 Score = 32.3 bits (70), Expect = 0.40 Identities = 15/42 (35%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = +2 Query: 497 HTFGGIIHRDLKPSNIAV---NEDCELKILDFGLARPTETEM 613 H+F + HRDLKP N+ + +E+ +K+ DFG A+ + ++ Sbjct: 36 HSFN-VAHRDLKPENLLLVDKSENLVVKLADFGFAKVDQGDL 76 >SB_35436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 20 Score = 31.9 bits (69), Expect = 0.52 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = +3 Query: 324 VIGLLDVFTPEKTLEDFQQV 383 +IGLL+VFTP++TLE F + Sbjct: 1 IIGLLNVFTPDRTLEQFNDL 20 >SB_26383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1142 Score = 31.9 bits (69), Expect = 0.52 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLA 592 +IHRDLK N+ + D +K+ DFG++ Sbjct: 350 VIHRDLKAGNLLLASDGNVKMADFGVS 376 Score = 29.5 bits (63), Expect = 2.8 Identities = 16/75 (21%), Positives = 40/75 (53%), Gaps = 2/75 (2%) Frame = +3 Query: 288 ELRMLKHXNHENVIGLLDVFTPEKTLEDFQQVYLVTHLMGADLNNIV--RTQKLSDDHVQ 461 E+ +L H+N++GL + F L D + ++ G L++++ + L++ ++ Sbjct: 278 EIDILSECKHKNLVGLFETF-----LHDGKLWMMLEFCSGGALDDLMLELERGLNEPEIR 332 Query: 462 FLVYQILRGLKYIHS 506 + Q+ GL+++H+ Sbjct: 333 AVTRQLFEGLQFLHN 347 >SB_14304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1219 Score = 31.9 bits (69), Expect = 0.52 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGLAR 595 GI HRDLK NI ++ E I DFG AR Sbjct: 187 GIAHRDLKLENILLSRKNEPIISDFGFAR 215 >SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) Length = 964 Score = 31.9 bits (69), Expect = 0.52 Identities = 15/31 (48%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Frame = +2 Query: 506 GGIIHRDLKPSNIAVNEDCE-LKILDFGLAR 595 G I+HRDLK NI +N+ + +KI DFG+++ Sbjct: 122 GQILHRDLKTQNILLNKKRKVVKIGDFGISK 152 >SB_13067| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 31.9 bits (69), Expect = 0.52 Identities = 17/29 (58%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKIL-DFGLA 592 GIIH D+KP+NI N E+ IL DFGL+ Sbjct: 44 GIIHGDIKPTNIMWNPVKEVFILGDFGLS 72 >SB_34104| Best HMM Match : SH2 (HMM E-Value=1.6e-24) Length = 421 Score = 31.5 bits (68), Expect = 0.69 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 +HRDL N+ V D +KI DFG++R Sbjct: 301 VHRDLAARNVLVVNDSFVKISDFGMSR 327 >SB_31555| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1063 Score = 31.5 bits (68), Expect = 0.69 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 +HRDL N V D +KI DFG++R Sbjct: 966 VHRDLATRNCLVGTDMVVKIADFGMSR 992 >SB_18047| Best HMM Match : Pkinase (HMM E-Value=2.1e-07) Length = 179 Score = 31.5 bits (68), Expect = 0.69 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLA 592 I HRD+K NI V D I DFGLA Sbjct: 48 IAHRDVKSKNILVKSDLTCCISDFGLA 74 >SB_51259| Best HMM Match : Pkinase_Tyr (HMM E-Value=3.4e-08) Length = 181 Score = 31.5 bits (68), Expect = 0.69 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLARPTETEMTGYVG 628 +IHRD+K N+ V+E + + DFGL + VG Sbjct: 37 LIHRDVKLQNVLVDEKSQGSLTDFGLCKAEGVMENSLVG 75 >SB_34086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 890 Score = 31.5 bits (68), Expect = 0.69 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCE----LKILDFGLARPTETEMTGYVGDKMV 640 G +HRD+KPSN A+ + +LDFGL+R T+ G V + V Sbjct: 43 GFLHRDIKPSNFAMGNTPDTVHICYMLDFGLSRQF-TKANGEVRPEQV 89 >SB_28695| Best HMM Match : Ras (HMM E-Value=0) Length = 1058 Score = 31.5 bits (68), Expect = 0.69 Identities = 12/28 (42%), Positives = 20/28 (71%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLAR 595 +IHRD+K NI + + +K++DFG A+ Sbjct: 300 VIHRDIKGGNIMLMPNGVIKLIDFGCAK 327 >SB_25669| Best HMM Match : LRR_1 (HMM E-Value=9.1e-33) Length = 1065 Score = 31.5 bits (68), Expect = 0.69 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 +HRDL N+ + + K+ DFGLAR Sbjct: 931 VHRDLAARNVLMTDTLTAKVADFGLAR 957 >SB_36661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 31.1 bits (67), Expect = 0.92 Identities = 17/31 (54%), Positives = 19/31 (61%), Gaps = 3/31 (9%) Frame = +2 Query: 509 GIIHRDLKPSNIAV---NEDCELKILDFGLA 592 GI HRDLKP NI N+ +KI DF LA Sbjct: 213 GIAHRDLKPENILCSHENKVSPVKICDFDLA 243 >SB_34401| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 2629 Score = 31.1 bits (67), Expect = 0.92 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLARPTETEM 613 +HRDL N+ V E KI D GLAR ++ Sbjct: 282 VHRDLAARNVLVGEHNTCKISDLGLARDVSQDI 314 >SB_16900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 451 Score = 31.1 bits (67), Expect = 0.92 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR-PTETEMTGYVGDK 634 IHRDL N V ++ +K+ DFGL+R +E T + G K Sbjct: 336 IHRDLAARNCLVGDNNLVKVADFGLSRLVSEDIYTAHQGAK 376 >SB_42333| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 31.1 bits (67), Expect = 0.92 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLA 592 I+HRDL N+ V + KI DFGLA Sbjct: 1 ILHRDLAARNVLVGTNNTCKITDFGLA 27 >SB_40820| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 526 Score = 31.1 bits (67), Expect = 0.92 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLARPTETEMTG 619 I DL N+ ++ED K+ DFGLAR + + G Sbjct: 364 IMTDLAARNVLIHEDGTAKVSDFGLARDADVIVEG 398 >SB_23777| Best HMM Match : Pkinase (HMM E-Value=0.065) Length = 97 Score = 31.1 bits (67), Expect = 0.92 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +3 Query: 273 KRTYRELRMLKHXNHENVIGLLDVFTPEKTL 365 K RE++MLK H N++ LL+VF ++ L Sbjct: 46 KIAMREVKMLKQLKHPNLVNLLEVFKRKRKL 76 >SB_17071| Best HMM Match : Pkinase (HMM E-Value=0.065) Length = 97 Score = 31.1 bits (67), Expect = 0.92 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +3 Query: 273 KRTYRELRMLKHXNHENVIGLLDVFTPEKTL 365 K RE++MLK H N++ LL+VF ++ L Sbjct: 46 KIAMREVKMLKQLKHPNLVNLLEVFKRKRKL 76 >SB_6592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1228 Score = 31.1 bits (67), Expect = 0.92 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 IHRDL NI V ++ +KI DFGL+R Sbjct: 983 IHRDLAARNILVVKENLVKISDFGLSR 1009 >SB_3739| Best HMM Match : Pkinase (HMM E-Value=0) Length = 490 Score = 31.1 bits (67), Expect = 0.92 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGLARPTETEM 613 G+IHRD+K +I + + +K+ DFG +M Sbjct: 332 GVIHRDIKSDSILLTSNGTVKLSDFGFCAQVTEDM 366 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 139 PERYQMLTPVGSGAYGQVCSAIDAQHSMKVAIKKL 243 PE +G G+ G VC A D + +VA+KK+ Sbjct: 215 PENLGNFMKIGEGSTGIVCLATDKRTGRQVAVKKM 249 >SB_53116| Best HMM Match : Pkinase (HMM E-Value=1.9e-09) Length = 481 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 4/32 (12%) Frame = +2 Query: 512 IIHRDLKPSNIAVNED----CELKILDFGLAR 595 ++HRDLKP+NI V D +KI D G AR Sbjct: 42 VLHRDLKPANILVMGDGPERGRVKIADMGFAR 73 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 2/26 (7%) Frame = +3 Query: 630 TRWYRAPEIMLHWMHYNP--NWWTFG 701 T WYRAPE++L HY + W G Sbjct: 91 TFWYRAPELLLGARHYTKAIDIWAIG 116 >SB_41076| Best HMM Match : Ras (HMM E-Value=1.90016e-42) Length = 704 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLAR 595 I+HRDL NI + +D KI D G+A+ Sbjct: 147 IVHRDLATKNILLTKDKRPKIADLGVAK 174 >SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1427 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLARPTETE 610 IHRDL N+ + + ++KI DFGL R E Sbjct: 288 IHRDLAARNVLLESNEKVKIGDFGLMRALSVE 319 >SB_10993| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.3e-38) Length = 344 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 +HRDL NI +N D + DFGL+R Sbjct: 165 VHRDLAARNIILNADNVAMVSDFGLSR 191 >SB_50960| Best HMM Match : Pkinase (HMM E-Value=0) Length = 632 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLA 592 I++RDLKP N+ +++ ++I D GLA Sbjct: 206 IVYRDLKPENLLLDDYGHVRISDLGLA 232 >SB_23137| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1022 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 +HRDL NI +N D + DFGL+R Sbjct: 843 VHRDLAARNIILNADNVAMVSDFGLSR 869 >SB_18879| Best HMM Match : Pkinase_Tyr (HMM E-Value=7e-36) Length = 617 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLARPTETEM 613 +HRDL N+ V E KI D GLAR ++ Sbjct: 457 VHRDLVARNVLVGEHNTCKISDLGLARDVSQDI 489 >SB_16221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 834 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 2/67 (2%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCEL-KILDFGLARP-TETEMTGYVGDKMVSCARDNAPLDAL*PK 685 ++HRDLKP N+ ++ ++ K+ DFG + E + A + DA Sbjct: 36 VVHRDLKPENVIFFKNQDMAKLTDFGFSNNFIPNEKLDTACGSLAYSAPEVLLGDAYEAP 95 Query: 686 LVDIWSV 706 VD+WS+ Sbjct: 96 AVDVWSL 102 >SB_2079| Best HMM Match : Pkinase (HMM E-Value=4.2e-10) Length = 210 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLAR 595 ++HRD+KP+N+ + +K+ D GL R Sbjct: 134 VMHRDIKPANVFITATGVVKLGDLGLGR 161 >SB_53713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 518 HRDLKPSNIAVNEDCELKILDFGLARPTET 607 HRDL N+ ++E K+ DFGL+R T Sbjct: 757 HRDLAARNVLLDEALTAKVSDFGLSRDIYT 786 >SB_37607| Best HMM Match : Pkinase_Tyr (HMM E-Value=9.3e-23) Length = 267 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 +HRDL NI +N D + DFGL+R Sbjct: 204 VHRDLAARNILLNVDNVAMVSDFGLSR 230 >SB_33716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 922 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = +3 Query: 288 ELRMLKHXNHENVIGLLDVFTPEKTLEDFQQVYLVTHLMGADLNNIVRTQKLSDD 452 E+ +L H N++ +LD F E+F QV + H G DL + Q D+ Sbjct: 638 EIALLAKLKHPNIVKMLDAFEN----EEFFQVVMEKHGTGMDLFEFIDRQPALDE 688 >SB_26337| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.3e-21) Length = 602 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 +HRDL NI +N D + DFGL+R Sbjct: 539 VHRDLAARNILLNVDNVAMVSDFGLSR 565 >SB_43494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 4/32 (12%) Frame = +2 Query: 509 GIIHRDLKPSNIAV----NEDCELKILDFGLA 592 G+IH DLKP NI + + +K++DFG A Sbjct: 218 GLIHADLKPENIMLVDPDKQPFRVKVIDFGSA 249 >SB_23465| Best HMM Match : Pkinase_Tyr (HMM E-Value=3.1e-07) Length = 1118 Score = 29.9 bits (64), Expect = 2.1 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 7/79 (8%) Frame = +1 Query: 85 TKMPRFHKVE-INKTEWIVPERYQML--TPVGSGAYGQVCSAIDAQHSMKVAIKK----L 243 T+ R H + + WI+P + TP+G+GA+G V + +VA+K+ + Sbjct: 919 TQDERRHDLRSLEPRNWIIPREEVTVSATPLGAGAWGSV--KVGTFRGSEVAVKQIHELI 976 Query: 244 ARPFNQLFMQREHTESCEC 300 P N+ +RE + + C Sbjct: 977 LSPHNRRLFEREMSIASRC 995 >SB_23400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 351 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGLAR 595 GIIH DL NI ++ K+ DFG +R Sbjct: 175 GIIHGDLAARNILLDSHANPKLADFGFSR 203 >SB_19615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1376 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFG--LARPTE-TEMTGYVGDKMVSCARDNAP 664 GI+HRDL N+ + + L + +FG L +P E T Y +K++ + + P Sbjct: 1201 GIVHRDLNAENLLLLDAGNLIVANFGNILQQPKETTSRFFYKAEKVIQSSGSHPP 1255 >SB_43344| Best HMM Match : Pkinase (HMM E-Value=6.9e-08) Length = 424 Score = 29.9 bits (64), Expect = 2.1 Identities = 7/26 (26%), Positives = 20/26 (76%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGL 589 ++HRD+K +N+ + + +++++DF + Sbjct: 147 VMHRDIKGANVMLTNEADIRLIDFAI 172 >SB_9759| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 387 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 +HRDL N V + +KI DFG++R Sbjct: 88 VHRDLATRNCLVGDGLVVKIADFGMSR 114 Score = 29.9 bits (64), Expect = 2.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 +HRDL N V + +KI DFG++R Sbjct: 271 VHRDLATRNCLVGDGLVVKIADFGMSR 297 >SB_39694| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 893 Score = 29.5 bits (63), Expect = 2.8 Identities = 19/35 (54%), Positives = 22/35 (62%), Gaps = 7/35 (20%) Frame = +2 Query: 512 IIHRDLKPSNI----AVNE---DCELKILDFGLAR 595 I+HRDLK NI +NE + LKI DFGLAR Sbjct: 204 IVHRDLKSGNILLHYKINESDFNNILKITDFGLAR 238 >SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 4/35 (11%) Frame = +2 Query: 512 IIHRDLKPSNI--AVNEDC--ELKILDFGLARPTE 604 I+H DLKP N+ + D +LK++DFG+A E Sbjct: 169 IVHLDLKPENVLCVIRPDGKEDLKLIDFGMAHIIE 203 >SB_21044| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1507 Score = 29.5 bits (63), Expect = 2.8 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 11/86 (12%) Frame = +3 Query: 282 YRELRMLKHXNHENVIGLLDVFTPEKTLEDFQQVYLVTHLMGADLNNIVRTQKLSDDH-- 455 ++E++++ HENV+ LL V +D +V ++ DLN ++ ++L+ + Sbjct: 284 FKEVKIMAGVRHENVVRLLGV------CKDDPMCMIVEYMENGDLNQFLKQRELASGNSA 337 Query: 456 ------VQFLVY---QILRGLKYIHS 506 Q L+Y Q+ G+KYI S Sbjct: 338 DPNKVTYQALLYMALQLAAGMKYIAS 363 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 +HRDL N V +KI DFG++R Sbjct: 367 VHRDLATRNCLVGHSFTVKIADFGMSR 393 >SB_34601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1391 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = -1 Query: 699 QMSTSLGYNASNGALSLAHDTILSPT*PVISVSVGLAKPKSKI 571 +M++ +G ASNGAL + + I VI ++G KP +I Sbjct: 2 RMASDVGVPASNGALLVGYQAITQTVFKVIFGALGDMKPSKRI 44 >SB_26833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 854 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +2 Query: 494 IHTFGGIIHRDLKPSNIAVNEDCELKILDF 583 IH I+HRDL P+NI + E+ ++ I F Sbjct: 320 IHKEKHIVHRDLTPNNIMLGENDKVTISTF 349 Score = 27.9 bits (59), Expect = 8.5 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 6/55 (10%) Frame = +3 Query: 357 KTLEDFQQVYLVTHLM-GADLNNIVRTQK-----LSDDHVQFLVYQILRGLKYIH 503 K E+ +++Y++ L+ GA L + K S++ + + QI+ GL+YIH Sbjct: 267 KAFEEKEKLYIIMELVEGAPLGEHFNSLKEKGTRFSEERIWHIFIQIVLGLRYIH 321 >SB_26127| Best HMM Match : Pkinase (HMM E-Value=5.3e-10) Length = 460 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = +3 Query: 435 QKLSDDHVQFLVYQILRGLKYIHS 506 ++LS+ ++ L+ Q+ +GLKYIHS Sbjct: 233 ERLSEADLKMLLLQLAQGLKYIHS 256 >SB_982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 28.7 bits (61), Expect = 4.9 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +1 Query: 25 CKPEN*SLIHNLHTANFKRTTKMPRFHKVEINKTEWIVPERYQMLTPVGSGAYGQV 192 C P I+ + + F TTK+ R + EI + +RY + +G G+YG+V Sbjct: 3 CDPGRFLRIYRIFRSKFWLTTKL-RSSRAEIGSLLNMSLDRYTIGKCIGKGSYGEV 57 >SB_41623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1604 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +1 Query: 103 HKVEINKTEWIVP-ERYQMLTPVGSGAYGQV 192 HK+ N EW P +R ++L VG+GA+GQV Sbjct: 1292 HKLPWN-AEWEFPRDRIKLLDIVGTGAFGQV 1321 >SB_19466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCE-LKILDFGLARPTETEM 613 G IH D+K +N+ V++ K+ DFG A +E ++ Sbjct: 38 GFIHNDIKGANVLVDDKGRTAKLTDFGSASSSENKV 73 >SB_7625| Best HMM Match : Pkinase (HMM E-Value=6.8e-10) Length = 279 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/27 (48%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Frame = +2 Query: 512 IIHRDLKPSNIAVNED--CELKILDFG 586 IIH DLKP NI + + +K++DFG Sbjct: 17 IIHCDLKPENILLKQQGRSGIKVIDFG 43 >SB_54232| Best HMM Match : Pkinase (HMM E-Value=1.1e-39) Length = 1123 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +2 Query: 524 DLKPSNIAVNEDCELKILDFGLAR 595 DLK NI + +D +KI DFG+AR Sbjct: 86 DLKTQNIFLTKDDVVKIGDFGIAR 109 >SB_51157| Best HMM Match : Pkinase (HMM E-Value=0.00029) Length = 161 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 527 LKPSNIAVNEDCELKILDFGLA 592 +KPSNI V+E K+ DFG++ Sbjct: 2 VKPSNILVDESGNFKLCDFGIS 23 >SB_41743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1436 Score = 28.3 bits (60), Expect = 6.5 Identities = 26/91 (28%), Positives = 41/91 (45%), Gaps = 4/91 (4%) Frame = +3 Query: 144 AISDAYTCRFRRLRSGLFCNRCPT*YESGY*KVSQ----TFQSAVHAKRTYRELRMLKHX 311 A+ A C+ R+ + L N CPT +++ SQ TF + +++ + ML Sbjct: 1336 AVPTAPPCKLRQHKPALLANSCPTVHKTKEMSESQFPILTFPLS-YSQSSGNSPAMLAGA 1394 Query: 312 NHENVIGLLDVFTPEKTLEDFQQVYLVTHLM 404 GLL V PEKT ++ LV L+ Sbjct: 1395 GAVYT-GLLSVRAPEKTAHQQPELTLVQRLV 1424 >SB_26513| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1460 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 3/28 (10%) Frame = +2 Query: 512 IIHRDLKPSNIAVNE---DCELKILDFG 586 +IH DLKP N+ V E L+++DFG Sbjct: 1294 VIHGDLKPDNVLVLESENSVALRLIDFG 1321 >SB_23902| Best HMM Match : Pkinase (HMM E-Value=2.29813e-43) Length = 1602 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLA 592 I HRDLK NI V ++ I D GLA Sbjct: 338 IAHRDLKSRNILVKDNGTCCIADLGLA 364 >SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 819 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 6/37 (16%) Frame = +2 Query: 512 IIHRDLKPSNI---AVNEDC---ELKILDFGLARPTE 604 I+H DLKP N+ + +C +K+ DFG AR E Sbjct: 608 IVHCDLKPENVLLAPITSECGYPAVKLCDFGFARIIE 644 >SB_13537| Best HMM Match : Pkinase (HMM E-Value=4e-11) Length = 253 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/23 (43%), Positives = 18/23 (78%) Frame = +2 Query: 524 DLKPSNIAVNEDCELKILDFGLA 592 D+KPSNI ++ + +K+ DFG++ Sbjct: 82 DVKPSNILLDRNGAIKLCDFGIS 104 >SB_47182| Best HMM Match : Pkinase (HMM E-Value=1e-09) Length = 198 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 521 RDLKPSNIAVNEDCELKILDFGLA 592 RD+K NI +N + K+ DFG+A Sbjct: 76 RDIKAGNILLNSEGHAKLADFGVA 99 >SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 28.3 bits (60), Expect = 6.5 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 2/67 (2%) Frame = +3 Query: 288 ELRMLKHXNHENVIGLLDVFTPEKTLEDFQQVYLVTHLM-GADL-NNIVRTQKLSDDHVQ 461 E+ +LK NH +I + DVF E +Y+V L+ G +L + +V ++ + + Sbjct: 99 EVNILKALNHPCIIEIADVF------ESPDMLYIVLELVEGGELFDRVVSVKRFEESVAK 152 Query: 462 FLVYQIL 482 L YQ++ Sbjct: 153 LLFYQMV 159 >SB_26437| Best HMM Match : Pkinase (HMM E-Value=3.6e-36) Length = 436 Score = 28.3 bits (60), Expect = 6.5 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Frame = +2 Query: 512 IIHRDLKPSNIAV----NEDCELKILDFGLARPTETE 610 +IH DLKP NI + E KI DFGL++ E++ Sbjct: 271 VIHYDLKPGNILLVGTGAFSGETKITDFGLSKIFESD 307 >SB_17544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 142 ERYQMLTPVGSGAYGQVCSAIDAQHSMKVAIKK 240 E+Y+ L VG G+YG V + VAIKK Sbjct: 112 EKYENLGLVGEGSYGMVMKCRHKDSNQIVAIKK 144 >SB_15977| Best HMM Match : Pkinase (HMM E-Value=2e-06) Length = 429 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 151 QMLTPVGSGAYGQVCSAIDAQHSMKVAIKKLARPFNQ 261 +M +G G GQVC + +A+K++AR N+ Sbjct: 203 EMSGEIGYGTCGQVCKMKHKKSGQVLAVKRMARSHNK 239 >SB_59022| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.4e-13) Length = 751 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/23 (47%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 127 EWIVP-ERYQMLTPVGSGAYGQV 192 +W VP ER ++ +G+GA+GQV Sbjct: 593 QWTVPRERIHIMKVIGNGAFGQV 615 >SB_47181| Best HMM Match : Pkinase (HMM E-Value=7.7e-31) Length = 801 Score = 27.9 bits (59), Expect = 8.5 Identities = 22/57 (38%), Positives = 27/57 (47%), Gaps = 11/57 (19%) Frame = +2 Query: 479 FTWTQ-------IHTFGGIIHRDLKPSNIAV----NEDCELKILDFGLARPTETEMT 616 F WTQ IHT GIIH+D+K N+ + E K+ DF A E E T Sbjct: 643 FYWTQVCMAVDHIHT-SGIIHKDIKAKNVLLCLNQGELHRAKLSDFDSAMWLEQEFT 698 >SB_36782| Best HMM Match : Pkinase (HMM E-Value=1.4e-32) Length = 310 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGL 589 GI+H DL+ N+ + + + I DFGL Sbjct: 131 GIVHTDLRSKNVFLELNSKAVITDFGL 157 >SB_25899| Best HMM Match : Ribonuc_2-5A (HMM E-Value=0) Length = 603 Score = 27.9 bits (59), Expect = 8.5 Identities = 12/32 (37%), Positives = 20/32 (62%), Gaps = 4/32 (12%) Frame = +2 Query: 512 IIHRDLKPSNIAVNE----DCELKILDFGLAR 595 I+HRD+KP N+ +++ + I DFGL + Sbjct: 308 IVHRDIKPHNVLISKATSGHVNVMISDFGLCK 339 >SB_23044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2162 Score = 27.9 bits (59), Expect = 8.5 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 329 WIAGCVYTGENIRRFSASILSDPSNGC 409 W +GC+ +G N+ S S ++P+ GC Sbjct: 160 WFSGCMESGTNVPFTSESKPTEPTPGC 186 >SB_18129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 515 IHRDLKPSNIAVNEDCELKILDFGLAR 595 +HRDL N+ + E + DFGL+R Sbjct: 69 VHRDLAARNVLLGRSLEPIVSDFGLSR 95 >SB_11623| Best HMM Match : ABC1 (HMM E-Value=0) Length = 780 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 4/31 (12%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDC----ELKILDFGL 589 G +H D P N+ V +DC E+ +LD GL Sbjct: 563 GYVHCDPHPGNVLVRKDCNGSVEIVLLDHGL 593 >SB_51111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 512 IIHRDLKPSNIAVNEDCELKILDFGLARPTETE 610 IIHRDLK N+ + +K+ DFG + E Sbjct: 179 IIHRDLKAENVFIAGPNLVKVGDFGFSTTATKE 211 >SB_28889| Best HMM Match : ANF_receptor (HMM E-Value=1.1e-34) Length = 933 Score = 27.9 bits (59), Expect = 8.5 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Frame = +2 Query: 494 IHTFGGIIHRDLKPSNIAVNEDCELKILDFGLA--RPTETEMTGYVGDKMVSC 646 IHT +H DL+ S ++ K+ DFGL +PT + V + C Sbjct: 547 IHTSSIHVHGDLRSSKCLIDSRWVCKVADFGLTCLKPTRGQTLKLVCMRNTQC 599 >SB_9676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 27.9 bits (59), Expect = 8.5 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 329 WIAGCVYTGENIRRFSASILSDPSNGC 409 W +GC+ +G N+ S S ++P+ GC Sbjct: 43 WFSGCMESGTNVPFTSESKPTEPTPGC 69 >SB_5071| Best HMM Match : RIO1 (HMM E-Value=0) Length = 556 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/49 (26%), Positives = 23/49 (46%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFGLARPTETEMTGYVGDKMVSCARD 655 G+IH D N+ +N+ ++ ++DF + D+ V C RD Sbjct: 288 GLIHCDFNEFNLMLNDKDQITVIDFPQMVSISHLNAQWYFDRDVQCIRD 336 >SB_2153| Best HMM Match : Laminin_G_2 (HMM E-Value=0.36) Length = 369 Score = 27.9 bits (59), Expect = 8.5 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 329 WIAGCVYTGENIRRFSASILSDPSNGC 409 W +GC+ +G N+ S S ++P+ GC Sbjct: 330 WFSGCMESGTNVPFTSESKPTEPTPGC 356 >SB_1165| Best HMM Match : Pkinase (HMM E-Value=5.6e-23) Length = 560 Score = 27.9 bits (59), Expect = 8.5 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +2 Query: 509 GIIHRDLKPSNIAVNEDCELKILDFG 586 G++H DLK N+ ++ +K+ DFG Sbjct: 458 GVVHLDLKGGNVLMDSKGIVKLADFG 483 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,981,850 Number of Sequences: 59808 Number of extensions: 477844 Number of successful extensions: 1363 Number of sequences better than 10.0: 189 Number of HSP's better than 10.0 without gapping: 1147 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1342 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -