BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0629 (698 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0100 + 13389899-13390219,13390723-13390841,13391220-133913... 29 2.7 >07_03_0100 + 13389899-13390219,13390723-13390841,13391220-13391315, 13391481-13391553,13392055-13392123 Length = 225 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/45 (31%), Positives = 27/45 (60%) Frame = +1 Query: 61 YSCKI*NSIKK*QRSAIVDLIAFDYFISYLLNLSICLGHTTTINE 195 ++C I + IK R +D I+ F++Y+L +SI L ++ +N+ Sbjct: 177 FTCAINSPIKLTMRHLYLDSISLFAFVNYILLVSIHLSNSQEVNQ 221 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,022,175 Number of Sequences: 37544 Number of extensions: 277624 Number of successful extensions: 469 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 462 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 469 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -