BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0628 (682 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 26 0.29 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 23 2.7 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 6.2 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 22 6.2 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 8.2 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 8.2 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 26.2 bits (55), Expect = 0.29 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 543 DYKYLSVHMGICDIVLFTNGNNPMFSLVQHHGTYFLDSLLF 665 D + ++ GIC + L NN +S + HG Y++++ F Sbjct: 241 DGESFTLKNGICGMALSPVTNNLYYSPLASHGLYYVNTAPF 281 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 23.0 bits (47), Expect = 2.7 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +1 Query: 634 TVLIFWIAFYLVLWTG 681 T+L+ WI Y +W G Sbjct: 179 TLLLVWILCYFCIWKG 194 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.8 bits (44), Expect = 6.2 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 604 IIRCFPWSNITVLIFWIAFYLVL 672 +I+ F S + V++ W +F+L L Sbjct: 203 LIQTFAPSTLVVMLSWFSFWLGL 225 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 21.8 bits (44), Expect = 6.2 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 399 TKNDILSSQKN*GILNSKKISFIRKYFQIVLK 494 TKN ++ K ILN++ I I+ I+LK Sbjct: 193 TKNKLIEESKTVFILNNEIIRSIQGTGTIILK 224 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/16 (37%), Positives = 9/16 (56%) Frame = +1 Query: 634 TVLIFWIAFYLVLWTG 681 T+ + WI Y +W G Sbjct: 212 TLAVVWIMCYFCIWKG 227 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 8.2 Identities = 6/16 (37%), Positives = 9/16 (56%) Frame = +1 Query: 634 TVLIFWIAFYLVLWTG 681 T+ + WI Y +W G Sbjct: 265 TLAVVWIMCYFCIWKG 280 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,810 Number of Sequences: 438 Number of extensions: 3708 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -