BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0626 (590 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0140 - 27982037-27983794 31 0.69 01_05_0142 - 18564697-18564792,18564824-18564928,18565606-185656... 27 8.5 >05_07_0140 - 27982037-27983794 Length = 585 Score = 31.1 bits (67), Expect = 0.69 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +2 Query: 182 LFSIINVPRLIYFYYFCKQSYMNKLIFKKKTGSQLQMSSVS 304 L +++ PR I+ + Q NKL F K+ GSQL + SV+ Sbjct: 257 LAALMCTPRSIHSWDIVVQRVGNKLFFDKRDGSQLDLLSVN 297 >01_05_0142 - 18564697-18564792,18564824-18564928,18565606-18565678, 18566262-18567637 Length = 549 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -2 Query: 364 KKPLWNCVXLFLAHDKKIKVTD 299 +K WNC+ LFL +++IK+ D Sbjct: 27 EKEKWNCLDLFLKLNREIKLED 48 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,343,785 Number of Sequences: 37544 Number of extensions: 205450 Number of successful extensions: 279 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 279 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 279 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1400060088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -