BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0625 (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosac... 26 4.5 SPAC13G7.05 |||acyl-coA-sterol acyltransferase |Schizosaccharomy... 25 7.9 >SPAC4F8.12c |spp42|cwf6|U5 snRNP complex subunit Spp42|Schizosaccharomyces pombe|chr 1|||Manual Length = 2363 Score = 26.2 bits (55), Expect = 4.5 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 3/60 (5%) Frame = +3 Query: 156 SLQ-KTVKKHIHLHNRRSYR*KRSLPDIRLI--YRKTVKYKNTAGMLRCTIDNTLLYKIY 326 SLQ +TV+K +H R+SY+ S DI L+ Y+ V + R +DNT K + Sbjct: 1627 SLQIETVQKET-IHPRKSYKMNSSCADILLLAAYKWNVSRPSLLNDNRDVLDNTTTNKYW 1685 >SPAC13G7.05 |||acyl-coA-sterol acyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 537 Score = 25.4 bits (53), Expect = 7.9 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -3 Query: 282 YLLYFYILQFFCKLNGCLEEIAFSDKTAYCA 190 YL+ FY++ F C LN E F+D+ Y A Sbjct: 392 YLIMFYLI-FDCILNAFAEITKFADRGFYGA 421 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,333,010 Number of Sequences: 5004 Number of extensions: 39495 Number of successful extensions: 68 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -