BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0625 (698 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0030 - 21698625-21698752,21699589-21699627,21699708-216998... 29 3.5 03_06_0030 + 31161821-31161927,31163700-31163934,31164064-311648... 28 8.2 >05_05_0030 - 21698625-21698752,21699589-21699627,21699708-21699822, 21699927-21699992,21701064-21701203,21701424-21701473, 21701608-21702045,21702757-21702839,21702941-21702977, 21703366-21703457,21703531-21703615,21703950-21704029, 21704049-21704105,21704350-21704747,21706322-21707223, 21707331-21707421,21708123-21710273,21710375-21710813, 21711180-21711299 Length = 1836 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +1 Query: 574 GTTALPISAVKQ*RVRFEGRGSRCNYTGSRIYIP 675 G T +PIS + R R GRGSRC SR ++P Sbjct: 145 GCTQVPISILVFHR-RLTGRGSRCRSPQSRSFMP 177 >03_06_0030 + 31161821-31161927,31163700-31163934,31164064-31164826, 31165816-31167650,31169294-31169424,31169993-31170075, 31170426-31170680,31171125-31171220,31171695-31171775, 31171811-31171968,31172434-31172534,31172614-31172629, 31173390-31173439,31174558-31174588,31175156-31175305, 31176135-31176173,31176288-31176410,31176496-31176552, 31176837-31176911,31177003-31177107 Length = 1496 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -3 Query: 657 PGIVTTAAPPFEPNALLLHGRNRQGGGTYPRGLTRR 550 PG+ + A P + LL G + GG++ LTRR Sbjct: 919 PGLTSLARPEIIEDIQLLEGLVQASGGSWQSSLTRR 954 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,113,004 Number of Sequences: 37544 Number of extensions: 257123 Number of successful extensions: 607 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 607 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -