BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0615 (685 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) 28 8.1 >SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) Length = 1217 Score = 27.9 bits (59), Expect = 8.1 Identities = 17/77 (22%), Positives = 38/77 (49%) Frame = -3 Query: 668 NHHLRKKWKVIVIATVNPKHTIDI*NPNTKIHXXXXXXXFNKKKRIFHNLN*PNTYSRYS 489 + L+K +++AT++ + + NT+ + K KR+ + LN NT +R S Sbjct: 304 SEELQKMASHVLLATLSVPIQVSL--SNTEKYLELDEVAREKSKRLANLLNLQNTPTRES 361 Query: 488 IIKVIIFNKRYPSTKFC 438 +++ ++ K + + C Sbjct: 362 LLQDMLLEKDFRPSDLC 378 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,119,180 Number of Sequences: 59808 Number of extensions: 245456 Number of successful extensions: 2354 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2305 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2354 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -