BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0613 (695 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i... 44 1e-04 At1g11530.1 68414.m01324 thioredoxin family protein similar to t... 41 7e-04 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 41 0.001 At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 40 0.001 At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica... 40 0.002 At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i... 37 0.011 At3g08710.1 68416.m01012 thioredoxin family protein similar to t... 37 0.015 At1g76760.1 68414.m08933 thioredoxin family protein similar to t... 36 0.026 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 35 0.045 At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38... 35 0.045 At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa... 35 0.045 At2g40790.1 68415.m05032 thioredoxin family protein contains Pfa... 33 0.14 At4g04950.1 68417.m00719 thioredoxin family protein similar to P... 33 0.24 At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i... 32 0.32 At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38... 32 0.32 At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa... 31 0.55 At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-... 31 0.96 At4g30290.1 68417.m04305 xyloglucan:xyloglucosyl transferase, pu... 28 5.1 At4g30280.1 68417.m04304 xyloglucan:xyloglucosyl transferase, pu... 28 5.1 At1g65310.1 68414.m07406 xyloglucan:xyloglucosyl transferase, pu... 28 5.1 At4g34060.1 68417.m04833 expressed protein similar to DEMETER pr... 28 6.8 At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-... 28 6.8 At3g53220.1 68416.m05864 thioredoxin family protein low similari... 27 9.0 At1g78740.1 68414.m09177 hypothetical protein 27 9.0 >At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA for thioredoxin GI:992963 Length = 133 Score = 43.6 bits (98), Expect = 1e-04 Identities = 17/35 (48%), Positives = 24/35 (68%) Frame = +3 Query: 42 ECEDIASEYNINSMPTFVFVKNGKKLDEFSGANVD 146 E D+A E+N+ +MPTFV VK GK+++ GA D Sbjct: 88 ELPDVAKEFNVTAMPTFVLVKRGKEIERIIGAKKD 122 >At1g11530.1 68414.m01324 thioredoxin family protein similar to thioredoxin H-type from Arabidopsis thaliana SP|P29448, Nicotiana tabacum SP|Q07090; contains Pfam profile: PF00085 Thioredoxin Length = 118 Score = 41.1 bits (92), Expect = 7e-04 Identities = 15/35 (42%), Positives = 26/35 (74%) Frame = +3 Query: 42 ECEDIASEYNINSMPTFVFVKNGKKLDEFSGANVD 146 E +++AS+ + +MPTF+F+K+G +D+ GAN D Sbjct: 65 EVKEVASQLEVKAMPTFLFLKDGNAMDKLVGANPD 99 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/33 (45%), Positives = 24/33 (72%) Frame = +3 Query: 42 ECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 140 E + +A E+ + +MPTFVF+K G+ +D+ GAN Sbjct: 70 ELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGAN 102 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 40.3 bits (90), Expect = 0.001 Identities = 14/33 (42%), Positives = 27/33 (81%) Frame = +3 Query: 42 ECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 140 + D+A+ +NI+S+PTF F+++GK++D+ GA+ Sbjct: 333 KANDVAASWNISSVPTFCFIRDGKEVDKVVGAD 365 >At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis thaliana} Length = 114 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/35 (48%), Positives = 25/35 (71%) Frame = +3 Query: 42 ECEDIASEYNINSMPTFVFVKNGKKLDEFSGANVD 146 E + +AS++ I +MPTF+F+K GK LD+ GA D Sbjct: 69 ELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKD 103 >At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5) {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA for thioredoxin GI:992965 Length = 118 Score = 37.1 bits (82), Expect = 0.011 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +3 Query: 42 ECEDIASEYNINSMPTFVFVKNGKKLDEFSGANVD 146 E + +A E+ + +MPTFVF+K G +D GA D Sbjct: 68 ELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKD 102 >At3g08710.1 68416.m01012 thioredoxin family protein similar to thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090 {Nicotiana tabacum}; contains Pfam profile: PF00085 Thioredoxin Length = 140 Score = 36.7 bits (81), Expect = 0.015 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = +3 Query: 42 ECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 140 E D +S ++I + PTF F+KNG+++ + GAN Sbjct: 86 ELSDFSSSWDIKATPTFFFLKNGQQIGKLVGAN 118 >At1g76760.1 68414.m08933 thioredoxin family protein similar to thioredoxin CH2, M-type, chloroplast precursor GB:P23400 SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam profile: PF00085 Thioredoxin Length = 172 Score = 35.9 bits (79), Expect = 0.026 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +3 Query: 6 RDSIXXXXXXXXECEDIASEYNINSMPTFVFVKNGKKLDEFSGA 137 +D I + IA++Y I ++PTF+ K+G+ D F GA Sbjct: 111 KDKIQVVKIDTEKYPSIANKYKIEALPTFILFKDGEPCDRFEGA 154 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 35.1 bits (77), Expect = 0.045 Identities = 12/32 (37%), Positives = 24/32 (75%) Frame = +3 Query: 42 ECEDIASEYNINSMPTFVFVKNGKKLDEFSGA 137 E + ++E+N+ + PT VF+K+G+++D+ GA Sbjct: 49 ELAEFSNEWNVEATPTVVFLKDGRQMDKLVGA 80 >At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 129 Score = 35.1 bits (77), Expect = 0.045 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +3 Query: 51 DIASEYNINSMPTFVFVKNGKKLDEFSGANVD 146 D+A Y ++P FVFVK G+++D GA D Sbjct: 87 DVAGTYRAITLPAFVFVKRGEEIDRVVGAKPD 118 >At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin; similar to thioredoxin GI:142153 from [Synechococcus PCC6301] Length = 167 Score = 35.1 bits (77), Expect = 0.045 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +3 Query: 54 IASEYNINSMPTFVFVKNGKKLDEFSGA 137 +A++Y I ++PTF+ K+GK D F GA Sbjct: 122 LANKYQIEALPTFILFKDGKLWDRFEGA 149 >At2g40790.1 68415.m05032 thioredoxin family protein contains Pfam profile: PF00085 thioredoxin Length = 154 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/33 (33%), Positives = 24/33 (72%) Frame = +3 Query: 42 ECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 140 E + + E+N+++ PT VF+K+G+++D+ G + Sbjct: 103 ELAEFSHEWNVDATPTVVFLKDGRQMDKLVGGD 135 >At4g04950.1 68417.m00719 thioredoxin family protein similar to PKCq-interacting protein PICOT from [Mus musculus] GI:6840949, [Rattus norvegicus] GI:6840951; contains Pfam profile PF00085: Thioredoxin Length = 488 Score = 32.7 bits (71), Expect = 0.24 Identities = 13/33 (39%), Positives = 22/33 (66%) Frame = +3 Query: 42 ECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 140 E +I+ Y++ ++P FVF K+GK +D GA+ Sbjct: 62 EHPEISEAYSVAAVPYFVFFKDGKTVDTLEGAD 94 >At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3) {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA for thioredoxin GI:992961 Length = 118 Score = 32.3 bits (70), Expect = 0.32 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 42 ECEDIASEYNINSMPTFVFVKNGKKLDEFSGA 137 E +A E+ + +MPTF+F+K G+ + GA Sbjct: 68 ELNTVAEEFKVQAMPTFIFMKEGEIKETVVGA 99 >At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana}; contains Pfam profile: PF00085 Thioredoxin Length = 148 Score = 32.3 bits (70), Expect = 0.32 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +3 Query: 63 EYNINSMPTFVFVKNGKKLDEFSGANVD 146 E+N++++P VF+K G+++D G VD Sbjct: 107 EFNLSTLPAIVFMKRGREVDMVVGVKVD 134 >At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam profile: PF00085 Thioredoxin Length = 160 Score = 31.5 bits (68), Expect = 0.55 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +3 Query: 42 ECEDIASEYNINSMPTFVFVKNGKKLDEFSGAN 140 E +I+ Y++ +P FVF K+GK +D GA+ Sbjct: 62 EHPEISEAYSVALVPYFVFFKDGKTVDTLEGAD 94 >At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4) nearly identical to SP|Q9SEU6 Thioredoxin M-type 4, chloroplast precursor (TRX-M4) {Arabidopsis thaliana} Length = 193 Score = 30.7 bits (66), Expect = 0.96 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 42 ECEDIASEYNINSMPTFVFVKNGKKLDEFSGA 137 E + A+ Y I S+PT + K G+K D GA Sbjct: 146 ESPNTANRYGIRSVPTVIIFKGGEKKDSIIGA 177 >At4g30290.1 68417.m04305 xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative similar to xyloglucan endotransglycosylase TCH4 GI:886116 from [Arabidopsis thaliana] Length = 277 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 355 QQNQYFLHSRGCKHKKLISSNSLQTLKTFFI 263 Q NQ FL+ + KL+ NS T+ TF++ Sbjct: 60 QSNQEFLYGKAEVQMKLVPGNSAGTVTTFYL 90 >At4g30280.1 68417.m04304 xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative similar to xyloglucan endotransglycosylase TCH4 GI:886116 from [Arabidopsis thaliana] Length = 282 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 355 QQNQYFLHSRGCKHKKLISSNSLQTLKTFFI 263 Q NQ FL+ + KL+ NS T+ TF++ Sbjct: 65 QSNQEFLYGKAEVQMKLVPGNSAGTVTTFYL 95 >At1g65310.1 68414.m07406 xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative similar to xyloglucan endotransglycosylase TCH4 GI:886116 from [Arabidopsis thaliana] Length = 282 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 355 QQNQYFLHSRGCKHKKLISSNSLQTLKTFFI 263 Q NQ FL+ + KL+ NS T+ TF++ Sbjct: 65 QSNQEFLYGKAEVQMKLVPGNSAGTVTTFYL 95 >At4g34060.1 68417.m04833 expressed protein similar to DEMETER protein [Arabidopsis thaliana] GI:21743571; expression supported by MPSS Length = 1073 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = -3 Query: 519 IIHLVRPDKNKNKNITIHTLKFLSNHLVKKTKIEIQ 412 I+ + + N+N NI + L+ +HLVK+ +EI+ Sbjct: 582 ILKFLNDEVNQNGNIDLEWLRNAPSHLVKRYLLEIE 617 >At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3) identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast precursor (TRX-M3) {Arabidopsis thaliana} Length = 173 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 54 IASEYNINSMPTFVFVKNGKKLDEFSG 134 +A EY I ++P + KNG+K + G Sbjct: 130 VAEEYEIKAVPVVLLFKNGEKRESIMG 156 >At3g53220.1 68416.m05864 thioredoxin family protein low similarity to SP|P29451 Thioredoxin [Rhesus macaque] {Macaca mulatta}; contains Pfam profile: PF00085 Thioredoxin Length = 126 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 69 NINSMPTFVFVKNGKKLDEFSGA 137 +I PTF F ++G+K+DE GA Sbjct: 91 HIRYTPTFQFYRDGEKVDEMFGA 113 >At1g78740.1 68414.m09177 hypothetical protein Length = 306 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -2 Query: 184 SIYLCLRIVVLSLSTLA-PENSSSFLPFLTKTNVG 83 +IY+C +V L LST+ P S LPFL +G Sbjct: 94 TIYICESLVSLKLSTVTLPSVKSVSLPFLRVLKLG 128 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,071,121 Number of Sequences: 28952 Number of extensions: 236360 Number of successful extensions: 498 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 492 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 498 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -