BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0610 (707 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g12010.1 68418.m01404 expressed protein 39 0.003 At4g29780.1 68417.m04241 expressed protein 39 0.003 At2g10980.1 68415.m01174 expressed protein 32 0.43 At3g55350.1 68416.m06147 expressed protein 31 0.57 At2g20240.1 68415.m02365 expressed protein 29 2.3 At1g26120.1 68414.m03188 esterase-related contains similaity to ... 29 3.0 At3g19120.1 68416.m02428 expressed protein 28 5.3 At1g70630.1 68414.m08141 expressed protein 28 7.0 At5g61950.1 68418.m07776 ubiquitin carboxyl-terminal hydrolase-r... 27 9.2 At1g24370.1 68414.m03073 hypothetical protein contains Pfam prof... 27 9.2 >At5g12010.1 68418.m01404 expressed protein Length = 502 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/78 (24%), Positives = 42/78 (53%) Frame = +2 Query: 14 ERLSVTLRYLASGNSIKSLYFEYLIGTTTLSEIIEHTCKSLWICLQPTYMPGKTEEDWIN 193 +R++V + LA+G ++ + ++ +G +T +++ CK++ L P Y+ +E N Sbjct: 212 QRVAVCIWRLATGEPLRLVSKKFGLGISTCHKLVLEVCKAIKDVLMPKYLQWPDDESLRN 271 Query: 194 IANFYFERTHFPNCLGSI 247 I + + PN +GS+ Sbjct: 272 IRERFESVSGIPNVVGSM 289 Score = 30.7 bits (66), Expect = 0.99 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +3 Query: 519 GDEAFPLMEHLMRPYPNRNLSIKQRVYNYSLSYARXTVECAFG 647 G PL++ ++ PY +NL+ Q +N +S + + AFG Sbjct: 373 GGPGHPLLDWVLVPYTQQNLTWTQHAFNEKMSEVQGVAKEAFG 415 >At4g29780.1 68417.m04241 expressed protein Length = 540 Score = 39.1 bits (87), Expect = 0.003 Identities = 21/79 (26%), Positives = 43/79 (54%), Gaps = 1/79 (1%) Frame = +2 Query: 14 ERLSVTLRYLASGNSIKSLYFEYLIGTTTLSEIIEHTCKSLWICLQPTYMPGKTEEDWIN 193 +R+ V + LA+G ++ + + +G +T +++ C++++ L P Y+ ++ + IN Sbjct: 250 KRVGVCVWRLATGAPLRHVSERFGLGISTCHKLVIEVCRAIYDVLMPKYLLWPSDSE-IN 308 Query: 194 IANFYFERTH-FPNCLGSI 247 FE H PN +GSI Sbjct: 309 STKAKFESVHKIPNVVGSI 327 Score = 35.5 bits (78), Expect = 0.035 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +3 Query: 516 VGDEAFPLMEHLMRPYPNRNLSIKQRVYNYSLSYARXTVECAF 644 VG+ FPL ++L+ PY +NL+ Q +N S+ + AF Sbjct: 410 VGNSGFPLTDYLLVPYTRQNLTWTQHAFNESIGEIQGIATAAF 452 >At2g10980.1 68415.m01174 expressed protein Length = 270 Score = 31.9 bits (69), Expect = 0.43 Identities = 21/78 (26%), Positives = 35/78 (44%) Frame = +2 Query: 17 RLSVTLRYLASGNSIKSLYFEYLIGTTTLSEIIEHTCKSLWICLQPTYMPGKTEEDWINI 196 + + T+R A G + ++ IG TT E + CK + + Y+ T++D I Sbjct: 67 KYTTTMRMFAYGVAADAVDEYSKIGGTTTLECLRRFCKGIIKLYETEYLRAPTQDDLQRI 126 Query: 197 ANFYFERTHFPNCLGSID 250 E FP +GSI+ Sbjct: 127 LR-VSEMRGFPGIIGSIN 143 >At3g55350.1 68416.m06147 expressed protein Length = 406 Score = 31.5 bits (68), Expect = 0.57 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +3 Query: 516 VGDEAFPLMEHLMRPYPNRNLSIKQRVYNYSLSYARXTVECA 641 VGD FPL+ L+ PY + S+ Q +N S A + A Sbjct: 277 VGDSGFPLLPWLLTPYQGKPTSLPQTEFNKRHSEATKAAQMA 318 >At2g20240.1 68415.m02365 expressed protein Length = 713 Score = 29.5 bits (63), Expect = 2.3 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +2 Query: 38 YLASGNSIKSLYFEYLIGTTTLSEIIEHTCKSLWIC 145 Y+ S+ +EYL+G T SEI+ + + W C Sbjct: 278 YMGDDCSLNRSNYEYLVGNITNSEIMSPSSRHSWDC 313 >At1g26120.1 68414.m03188 esterase-related contains similaity to esterase 6 GI:606998 from [Drosophila simulans] and esterase GI:12584120 from [Sphingomonas elodea] Length = 476 Score = 29.1 bits (62), Expect = 3.0 Identities = 18/66 (27%), Positives = 32/66 (48%) Frame = +1 Query: 286 GSEAFNYKKYYSLILLAIADADYCFTAIDFGAYGSNSDSSVFKNSNFGKRFLNNQMHLPE 465 G+ YK + SL+ +++ D ID+ + S S + K+++ G F+ N H+ E Sbjct: 215 GAWIIGYKAWGSLLGQQLSERDIIVACIDYRNFPQGSISDMVKDASSGISFVCN--HIAE 272 Query: 466 SATLPD 483 PD Sbjct: 273 YGGDPD 278 >At3g19120.1 68416.m02428 expressed protein Length = 446 Score = 28.3 bits (60), Expect = 5.3 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 516 VGDEAFPLMEHLMRPY-PNRNLSIKQRVYNYSLSYARXTVECAFGIM 653 VGD +PL+ LM P+ PN + + + +++ L R V A G++ Sbjct: 317 VGDWCYPLLSFLMTPFSPNGSGTPPENLFDGMLMKGRSVVVEAIGLL 363 >At1g70630.1 68414.m08141 expressed protein Length = 537 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 425 KFEFLKTLESLFDPYAPKSIA 363 +F L+ L FDPYAPK+I+ Sbjct: 314 QFSILQGLPVFFDPYAPKNIS 334 >At5g61950.1 68418.m07776 ubiquitin carboxyl-terminal hydrolase-related contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1132 Score = 27.5 bits (58), Expect = 9.2 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +2 Query: 116 EHTC----KSLWICLQPTYMPGKTEEDWINIANFYFERTHFPNCL 238 EH C K+ W+ L+ G+ DW N+ F ER P L Sbjct: 1079 EHVCLAYEKNRWVNLRRECFAGEDVGDWKNVVRFCGERKVRPEIL 1123 >At1g24370.1 68414.m03073 hypothetical protein contains Pfam profiles PF04776: Protein of unknown function (DUF626), PF04827: Protein of unknown function (DUF635) Length = 413 Score = 27.5 bits (58), Expect = 9.2 Identities = 18/59 (30%), Positives = 29/59 (49%) Frame = +1 Query: 247 RWKHIRIERPENTGSEAFNYKKYYSLILLAIADADYCFTAIDFGAYGSNSDSSVFKNSN 423 +WK+ P G + + ++IL A+AD D FG GSN+D +V + S+ Sbjct: 81 KWKNC----PTAWGGQYAGRSRSPTIILEAVADYDLWIWHAYFGLPGSNNDINVLEASH 135 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,781,604 Number of Sequences: 28952 Number of extensions: 338099 Number of successful extensions: 838 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 838 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1526202912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -