BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0606 (649 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0TVK8 Cluster: Putative uncharacterized protein; n=1; ... 34 3.4 UniRef50_UPI000045D59E Cluster: hypothetical protein Haso0200007... 33 6.0 >UniRef50_Q0TVK8 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 886 Score = 33.9 bits (74), Expect = 3.4 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +1 Query: 58 ATFTETPLQRHVSLIIRRPHDKIMITFDD 144 +T +P+Q H L + RP D+ MITFDD Sbjct: 94 STNAPSPIQGHTLLNLTRPEDQFMITFDD 122 >UniRef50_UPI000045D59E Cluster: hypothetical protein Haso02000078; n=1; Haemophilus somnus 2336|Rep: hypothetical protein Haso02000078 - Haemophilus somnus 2336 Length = 311 Score = 33.1 bits (72), Expect = 6.0 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 4/55 (7%) Frame = +1 Query: 52 KNATFTETPL----QRHVSLIIRRPHDKIMITFDDDSANVTCASHDVQREKHNIK 204 KN TF L +R++ +I+ K + TFDD +AN+ SH Q H++K Sbjct: 83 KNKTFDRVFLANIEKRYIHIILSNIFFKELYTFDDGTANIAPNSHLYQEYDHSLK 137 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 500,735,703 Number of Sequences: 1657284 Number of extensions: 8159455 Number of successful extensions: 17369 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17031 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17365 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48955894634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -