BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0606 (649 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27527| Best HMM Match : MFAP1_C (HMM E-Value=0.57) 29 2.5 SB_47334| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 >SB_27527| Best HMM Match : MFAP1_C (HMM E-Value=0.57) Length = 818 Score = 29.5 bits (63), Expect = 2.5 Identities = 19/75 (25%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Frame = +1 Query: 1 RHEHTVSRSDDKINATKKNATFTETPLQRHVSLI-IRRPHDKIMITFDDDSANVTCASHD 177 R+E+ + S + +N T +NA E SL R H + + DD A + + Sbjct: 301 RYENAIKYSPESVNKTIRNALIEEKQKYEAESLAESLRAHVEHLEAMDDSDATEASSEDE 360 Query: 178 VQREKHNIKSEQAKS 222 + E++ S Q+K+ Sbjct: 361 SEDEEYYSSSLQSKT 375 >SB_47334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 28.7 bits (61), Expect = 4.3 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = +1 Query: 388 LXLLNTYSRFGTTYNTLYTVKWGELGHFPNPTLISNKIMV*WFREFKFVY 537 L L+ Y++F +YNT+Y K L H+ N + ++ I V REF+ + Sbjct: 205 LYLIILYTKFTVSYNTIYAFK---LLHYSN-SFVNPIIFVIKMREFRAAF 250 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,562,450 Number of Sequences: 59808 Number of extensions: 267053 Number of successful extensions: 522 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 485 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 522 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -