Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0604
         (728 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g04710.1 68417.m00692 calcium-dependent protein kinase, putat...    27   9.6  

>At4g04710.1 68417.m00692 calcium-dependent protein kinase, putative
           / CDPK, putative similar to calcium-dependent protein
           kinase [Nicotiana tabacum] gi|3283996|gb|AAC25423;
           contains protein kinase domain, Pfam:PF00069; contains
           EF hand domain (calcium-binding EF-hand), Pfam:PF00036,
           INTERPRO:IPR002048
          Length = 575

 Score = 27.5 bits (58), Expect = 9.6
 Identities = 16/47 (34%), Positives = 23/47 (48%)
 Frame = -3

Query: 150 PLFSSEI*VLRSQYNYNGCPTVQTETHYCFTAEIGQGGGTYPCACSP 10
           PL +S+I   + Q    G P    + HY F  E+G+ G +Y C   P
Sbjct: 9   PLTASDIVSDQKQETILGKPLEDIKKHYSFGDELGK-GKSYACKSIP 54


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,292,536
Number of Sequences: 28952
Number of extensions: 297852
Number of successful extensions: 664
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 651
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 663
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1594686376
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)