BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0601 (558 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. 25 1.3 AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. 25 1.3 AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. 25 1.3 AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. 25 1.3 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 25 1.3 AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 23 5.1 AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection... 23 5.1 AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 23 6.8 >AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.3 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 107 CSAFMSFVTIFLECPDGSKWLVCSDASFLVRC 12 CS SF F E DG + +CS +RC Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.3 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 107 CSAFMSFVTIFLECPDGSKWLVCSDASFLVRC 12 CS SF F E DG + +CS +RC Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.3 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 107 CSAFMSFVTIFLECPDGSKWLVCSDASFLVRC 12 CS SF F E DG + +CS +RC Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.3 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 107 CSAFMSFVTIFLECPDGSKWLVCSDASFLVRC 12 CS SF F E DG + +CS +RC Sbjct: 47 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 78 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 25.4 bits (53), Expect = 1.3 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 107 CSAFMSFVTIFLECPDGSKWLVCSDASFLVRC 12 CS SF F E DG + +CS +RC Sbjct: 623 CSCDESFFGPFCETKDGEQPALCSSYEDCIRC 654 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 23.4 bits (48), Expect = 5.1 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 126 HQTLDGLLINRQLWLAEGLLSCQTKG 203 H DGLL R L + EGL Q G Sbjct: 128 HDQDDGLLDERYLEVLEGLKEAQAAG 153 >AJ237664-1|CAB40379.2| 81|Anopheles gambiae putative infection responsive shortpeptide protein. Length = 81 Score = 23.4 bits (48), Expect = 5.1 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 Query: 189 CQTKGGRYCGY 221 C++ G RYCGY Sbjct: 32 CKSIGARYCGY 42 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 23.0 bits (47), Expect = 6.8 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +3 Query: 276 FFCSHKISTSPTHRGCDLERDNATNEPSSKSVYFGRNTVPVSDLE*WAR 422 F + T P G ++ R++ S S FG TVPV ++ ++R Sbjct: 314 FASIRRTMTIPRSYGTNV-RESRRQLNISSSQLFGNGTVPVQQIQLYSR 361 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 544,362 Number of Sequences: 2352 Number of extensions: 12225 Number of successful extensions: 23 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52142868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -