BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0598 (677 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC663.15c |||conserved fungal protein|Schizosaccharomyces pomb... 33 0.050 SPAC23H4.14 |vam6|vps39|guanyl-nucleotide exchange factor Vma6|S... 25 7.6 >SPCC663.15c |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 657 Score = 32.7 bits (71), Expect = 0.050 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -2 Query: 136 FKWRKWKLKKDGTKILYFINLVMYYTGCFLCFI 38 F W +L K G ++ FINLV Y CF+ FI Sbjct: 474 FLWDVIQLSKAGAPLVKFINLVERYQSCFVRFI 506 >SPAC23H4.14 |vam6|vps39|guanyl-nucleotide exchange factor Vma6|Schizosaccharomyces pombe|chr 1|||Manual Length = 905 Score = 25.4 bits (53), Expect = 7.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 72 SCITQDAFYALSIVKVSI 19 SC TQD FYALS +V + Sbjct: 74 SCATQDIFYALSDSQVYV 91 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,370,351 Number of Sequences: 5004 Number of extensions: 42531 Number of successful extensions: 81 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 311890690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -