BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0597 (661 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11830| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_46097| Best HMM Match : zf-CCHC (HMM E-Value=7.2e-05) 28 7.7 >SB_11830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 271 Score = 29.9 bits (64), Expect = 1.9 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = +3 Query: 522 IVAEFVSIAQ*FFFFNSRRDRIKTFKPVFISKGFLFALICDYLGM 656 ++A+F I+Q F FF +R ++ P+F S FL ++ +GM Sbjct: 40 LIAQFFLISQSFLFFVARFVWLRVGPPLFKSPNFLARMLMYLVGM 84 >SB_46097| Best HMM Match : zf-CCHC (HMM E-Value=7.2e-05) Length = 430 Score = 27.9 bits (59), Expect = 7.7 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = -1 Query: 358 LRSRYSYNGCPALRTETRYCFTAEXGRAVVPTRADHKTSYHQ 233 LR +S CPA + E R C + G R+ K+S HQ Sbjct: 110 LRHSFSQGKCPAFKQECRKC--KKVGHFARVCRSTRKSSVHQ 149 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,180,552 Number of Sequences: 59808 Number of extensions: 306528 Number of successful extensions: 681 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 612 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -