BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0595 (662 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z77657-7|CAH60768.1| 320|Caenorhabditis elegans Hypothetical pr... 27 9.0 Z22176-11|CAA80141.1| 784|Caenorhabditis elegans Hypothetical p... 27 9.0 >Z77657-7|CAH60768.1| 320|Caenorhabditis elegans Hypothetical protein F08H9.12 protein. Length = 320 Score = 27.5 bits (58), Expect = 9.0 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = -1 Query: 218 TDTILSIAPIFKQSCIL*RGFHIALQVARLTVFFSTFVTSLYYLL 84 T I+S + IF +S I FH+ Q+ + +F S+ YLL Sbjct: 89 TSVIISFSLIFVESYI----FHVIQQIIHILLFLLAIANSIKYLL 129 >Z22176-11|CAA80141.1| 784|Caenorhabditis elegans Hypothetical protein ZK1098.3 protein. Length = 784 Score = 27.5 bits (58), Expect = 9.0 Identities = 17/63 (26%), Positives = 30/63 (47%) Frame = +3 Query: 426 FKV*RFRRIVEKSSLTNNSGSEKSAILNNSSKTNYYLNL*NPLHSLQEHPSHKINSRKCE 605 FK+ + ++ SL N + ILN S+KT+ L + L L+ S + + +C Sbjct: 532 FKIENIQNVICVKSLAENVNALSMDILNLSTKTSKLSVLADHLVGLKMDKSEQCGNWQCR 591 Query: 606 PTK 614 P + Sbjct: 592 PLR 594 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,992,444 Number of Sequences: 27780 Number of extensions: 265489 Number of successful extensions: 528 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 515 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 528 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1486926498 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -