BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0594 (590 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8IAK0 Cluster: Putative uncharacterized protein PF00_0... 36 0.71 >UniRef50_Q8IAK0 Cluster: Putative uncharacterized protein PF00_0001; n=1; Plasmodium falciparum|Rep: Putative uncharacterized protein PF00_0001 - Plasmodium falciparum Length = 677 Score = 35.9 bits (79), Expect = 0.71 Identities = 17/82 (20%), Positives = 40/82 (48%) Frame = -2 Query: 544 YSELDYCIQITVIKHRLLSVILHVATTIVLCPYLDNVYITLVSEIRKSFCTERYYMI*IT 365 Y +++C+++ ++++ S I + +C Y++N I ++ ++ F + Y I Sbjct: 65 YLSINHCLKLYYLQNKNSSYIYNTRLLTYICRYINNTPINIILNLKNEFILDYIYNCNIY 124 Query: 364 SFKGTFRIGYIAANLSFRFLYN 299 +K F+ Y + F+YN Sbjct: 125 KYKYFFQTEY------YHFIYN 140 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 490,263,539 Number of Sequences: 1657284 Number of extensions: 8992730 Number of successful extensions: 16119 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 15628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16113 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 41073165837 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -