BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0594 (590 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0522 - 4506667-4507254,4507474-4507824,4507967-4508163,450... 29 2.8 01_06_0715 + 31416338-31416500,31416601-31416710,31416808-314168... 29 3.7 03_04_0075 + 17066321-17066381,17066476-17067534,17067641-17067927 28 4.8 >05_01_0522 - 4506667-4507254,4507474-4507824,4507967-4508163, 4508324-4508582,4508656-4508868,4508946-4509071, 4509159-4509296,4509376-4509721,4509822-4510088, 4510427-4510616,4510700-4510784,4510885-4511072, 4511262-4511457,4512027-4512113 Length = 1076 Score = 29.1 bits (62), Expect = 2.8 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +3 Query: 57 LSRKKYINLIMPVYESRALHAYCVSVVIRIL-NKFL*VTNLLNY*NIHYV 203 L R YIN I+ S L AYCV I +L NKF+ + + NY + ++ Sbjct: 843 LERLAYINTIVYPITSIPLIAYCVLPAICLLTNKFI-IPEISNYAGMFFI 891 >01_06_0715 + 31416338-31416500,31416601-31416710,31416808-31416880, 31416988-31417135,31417867-31418133,31418234-31418576, 31418665-31418802,31419389-31419514,31419626-31419838, 31419918-31420164,31420247-31420446,31420538-31420891, 31420984-31421568 Length = 988 Score = 28.7 bits (61), Expect = 3.7 Identities = 20/58 (34%), Positives = 28/58 (48%) Frame = +3 Query: 57 LSRKKYINLIMPVYESRALHAYCVSVVIRILNKFL*VTNLLNY*NIHYVRQQGLFVSV 230 L R YIN I+ + S L AYC I +L + L N I ++ GLF+S+ Sbjct: 756 LQRLSYINTIVYPFTSLPLIAYCCLPAICLLTGKFIIPTLSNAATIWFL---GLFISI 810 >03_04_0075 + 17066321-17066381,17066476-17067534,17067641-17067927 Length = 468 Score = 28.3 bits (60), Expect = 4.8 Identities = 15/33 (45%), Positives = 22/33 (66%) Frame = -1 Query: 536 VRLLYTDYCNKAQIAISNFTCSHNYSIMSLLRQ 438 V+L Y DY +A+IAI+NF NY+ +L+ Q Sbjct: 318 VKLNYKDYW-RAKIAITNFNYRMNYTQWTLVAQ 349 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,256,659 Number of Sequences: 37544 Number of extensions: 211707 Number of successful extensions: 315 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 315 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1400060088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -