BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0594 (590 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81036-5|CAB02743.2| 768|Caenorhabditis elegans Hypothetical pr... 27 7.5 Z81579-5|CAB04654.3| 1305|Caenorhabditis elegans Hypothetical pr... 27 10.0 AY959881-1|AAX56914.1| 1305|Caenorhabditis elegans nephrocystin-... 27 10.0 >Z81036-5|CAB02743.2| 768|Caenorhabditis elegans Hypothetical protein C16C2.3a protein. Length = 768 Score = 27.5 bits (58), Expect = 7.5 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 7/54 (12%) Frame = +3 Query: 369 IYII*YLSVQNDFRISDTNVMYT-------LSK*GHNTIVVATCKITDSNLCFI 509 I++I + +V + R+SD NV Y ++K G+ + K+ D+ +CF+ Sbjct: 179 IFVIVFQAVNSKVRVSDVNVKYVATGISVLVNKLGNKGGTAVSMKMNDTWVCFV 232 >Z81579-5|CAB04654.3| 1305|Caenorhabditis elegans Hypothetical protein R13H4.1 protein. Length = 1305 Score = 27.1 bits (57), Expect = 10.0 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 376 SYNIFQCKMIFVFPIPTLCIHCLSRDII 459 +YNIF+ IF +P CI C +DII Sbjct: 166 TYNIFEMPPIFFQCLPEFCIVC-DKDII 192 >AY959881-1|AAX56914.1| 1305|Caenorhabditis elegans nephrocystin-4-like protein protein. Length = 1305 Score = 27.1 bits (57), Expect = 10.0 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 376 SYNIFQCKMIFVFPIPTLCIHCLSRDII 459 +YNIF+ IF +P CI C +DII Sbjct: 166 TYNIFEMPPIFFQCLPEFCIVC-DKDII 192 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,865,958 Number of Sequences: 27780 Number of extensions: 233612 Number of successful extensions: 428 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 428 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1247656244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -