BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0593 (685 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81587-2|CAB04702.2| 339|Caenorhabditis elegans Hypothetical pr... 28 7.1 Z93388-12|CAB07661.2| 294|Caenorhabditis elegans Hypothetical p... 27 9.4 >Z81587-2|CAB04702.2| 339|Caenorhabditis elegans Hypothetical protein T06G6.2 protein. Length = 339 Score = 27.9 bits (59), Expect = 7.1 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = +3 Query: 345 SYYFTRKRKKRNFWLFRNNLCYTSNWVIRIYCLSSSYIH 461 SYYF R R W +NN+ S +I + CL +S IH Sbjct: 42 SYYFARLAI-RTLW--KNNIFSNSTRLILLVCLLNSIIH 77 >Z93388-12|CAB07661.2| 294|Caenorhabditis elegans Hypothetical protein T10C6.4 protein. Length = 294 Score = 27.5 bits (58), Expect = 9.4 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = +3 Query: 264 NFISTFILIFWTS*SLYFNFTRIWYNFSYYF 356 N++ T+I+I WT + +++ +YN S+ F Sbjct: 111 NYVLTYIIINWTLPPVIYSYFFFFYNCSFPF 141 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,915,120 Number of Sequences: 27780 Number of extensions: 189121 Number of successful extensions: 392 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 375 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 392 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1560745544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -