BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0592 (627 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1A6.09c |lag1||sphingosine N-acyltransferase Lag1|Schizosacc... 28 0.96 SPCC794.08 |||HEAT repeat protein, unknown biological role|Schiz... 25 9.0 SPAC11E3.01c |swr1|SPAC2H10.03c|SNF2 family helicase Swr1|Schizo... 25 9.0 >SPAC1A6.09c |lag1||sphingosine N-acyltransferase Lag1|Schizosaccharomyces pombe|chr 1|||Manual Length = 390 Score = 28.3 bits (60), Expect = 0.96 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Frame = +1 Query: 46 SILIVCIA--ISPGRRPLADPFYILTF 120 SI+ +C A +SP RP A+PF L++ Sbjct: 75 SIIAICFACLLSPSLRPYAEPFIFLSY 101 >SPCC794.08 |||HEAT repeat protein, unknown biological role|Schizosaccharomyces pombe|chr 3|||Manual Length = 798 Score = 25.0 bits (52), Expect = 9.0 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = -1 Query: 312 KRQTKKKMQCSASNSRNYFLYSSDLDSGRVHTFESVFIDYLTS 184 K TKK+ S ++ L+S + R+HT +S F+ T+ Sbjct: 446 KLNTKKESSAPLSLVTDFLLHSWPKSAERLHTSQSPFVRIKTA 488 >SPAC11E3.01c |swr1|SPAC2H10.03c|SNF2 family helicase Swr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1288 Score = 25.0 bits (52), Expect = 9.0 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = -3 Query: 520 LKRSKCRRKTIFGDELQRSDAHNNTHNVSYIYLLPAK 410 L SKC I+G L R H+ S Y L AK Sbjct: 864 LNESKCSHSPIYGSNLIRLAEKLPKHSTSIDYTLYAK 900 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,325,680 Number of Sequences: 5004 Number of extensions: 42672 Number of successful extensions: 112 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 277683324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -