BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0590 (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory pro... 22 5.5 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 21 9.7 >DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory protein 4 protein. Length = 133 Score = 21.8 bits (44), Expect = 5.5 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -2 Query: 211 VEVERLQVLERLIGSTVDC*LRERR 137 +++E + ERL+ S VDC L + R Sbjct: 33 IDLENVVKNERLLKSYVDCLLEKGR 57 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 21.0 bits (42), Expect = 9.7 Identities = 9/30 (30%), Positives = 12/30 (40%) Frame = -3 Query: 231 DKLLVGGWKLKDYKCSNDSLDRPSTANCES 142 +KL G DY + D P +C S Sbjct: 65 EKLCPDGMVFNDYSSEYEKCDLPFNIDCTS 94 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,660 Number of Sequences: 336 Number of extensions: 3127 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -