BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0590 (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43441| Best HMM Match : Lipase (HMM E-Value=8.19998e-41) 31 1.2 SB_20887| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 >SB_43441| Best HMM Match : Lipase (HMM E-Value=8.19998e-41) Length = 291 Score = 30.7 bits (66), Expect = 1.2 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -3 Query: 234 YDKLLVGGWKLKDYKCSNDSLDRPSTANC 148 +D +GG+K Y+CSN++++R C Sbjct: 263 WDGTFIGGFKASPYRCSNNNVERQMHRKC 291 >SB_20887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -3 Query: 675 PGTKKKEKNGYSHKNVFCQF-KIRFTIKRRVILVNADKRTDFERAV 541 P T+K KNG+S K +CQ ++ F +V + D++ V Sbjct: 139 PQTQKTMKNGFSAKRAWCQHRRVGFFCNFKVDIAQQSSGNDYDCGV 184 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,464,509 Number of Sequences: 59808 Number of extensions: 376491 Number of successful extensions: 752 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -