BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0587 (679 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF067942-9|AAG45572.1| 347|Caenorhabditis elegans Hypothetical ... 28 7.0 >AF067942-9|AAG45572.1| 347|Caenorhabditis elegans Hypothetical protein ZK6.2 protein. Length = 347 Score = 27.9 bits (59), Expect = 7.0 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = -2 Query: 258 FNFTVFSVN*TDVWKRSLLAIRPPIVQMYVLFDCFLK*NFFRRVRVKFLQM*RHAGM 88 FN++V S N ++ R L+ PI + ++ +CF + F R+ Q H GM Sbjct: 18 FNYSVPSCNACKIFFRRLITRTMPIKKCFLGENCFERPPFTRKCAACRFQKCLHVGM 74 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,766,756 Number of Sequences: 27780 Number of extensions: 234032 Number of successful extensions: 480 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 480 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1539654388 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -