BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0584 (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g53300.1 68414.m06041 thioredoxin family protein contains Pfa... 29 3.9 At3g01030.1 68416.m00004 zinc finger (C2H2 type) family protein ... 28 6.8 At5g63060.1 68418.m07912 SEC14 cytosolic factor, putative 27 9.0 At3g52600.1 68416.m05794 beta-fructosidase, putative / beta-fruc... 27 9.0 At3g02860.2 68416.m00279 expressed protein 27 9.0 At3g02860.1 68416.m00278 expressed protein 27 9.0 >At1g53300.1 68414.m06041 thioredoxin family protein contains Pfam profiles PF00085: Thioredoxin, PF00515: TPR Domain; similar to tetratricopeptide repeat protein 2 (GI:7248701) [Drosophila melanogaster]; similar to DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) (TPR repeat protein 2) (Swiss-Prot:Q99615) [Homo sapiens] Length = 699 Score = 28.7 bits (61), Expect = 3.9 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 6/68 (8%) Frame = +1 Query: 127 GLSSFTRTGGRAKAQPRGVGFANNCP------SASEGTLTTQEQLFRE*STTGSESRPAE 288 G S R GG + A+P G +N P S S T+ T E + + GS+S + Sbjct: 172 GHGSIMRGGGISPAKPTNTGGGSNSPVNVGSSSRSSSTVATGETPIWKKAILGSDSEEVK 231 Query: 289 KIRRETQR 312 ++ E R Sbjct: 232 RVGNEMYR 239 >At3g01030.1 68416.m00004 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 353 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -3 Query: 606 GLESIRKYMKSTSKRYFDKAMRHDNRLIVAAADT 505 GLE K + ST +++ D +R++ RL+ A D+ Sbjct: 175 GLEHFGKALGSTQRKFEDGLLRNEQRLVGEALDS 208 >At5g63060.1 68418.m07912 SEC14 cytosolic factor, putative Length = 268 Score = 27.5 bits (58), Expect = 9.0 Identities = 21/75 (28%), Positives = 32/75 (42%) Frame = -3 Query: 684 SLQSRFCRLAVGAPWFVRNVDLHDDLGLESIRKYMKSTSKRYFDKAMRHDNRLIVAAADT 505 SL R CR+ + N+D D+L +SI K T K Y + R +V A Sbjct: 88 SLLCRTCRIKSHVVFCFGNIDKVDELSEDSI-KAATDTGKAYVHGFLDVKGRPVVIVAPA 146 Query: 504 PRILIMQEPVTVDAL 460 I + +P+ + L Sbjct: 147 KHIPGLLDPIEDEKL 161 >At3g52600.1 68416.m05794 beta-fructosidase, putative / beta-fructofuranosidase, putative similar to beta-fructofuranosidase [Daucus carota] GI:18324 Length = 590 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -2 Query: 505 SPNPDHAGASHRRRPRHVLTDPSDPITF 422 S +P H A H + PRH + DP+ P+ + Sbjct: 42 SVSPLHRTAYHFQPPRHWINDPNAPMLY 69 >At3g02860.2 68416.m00279 expressed protein Length = 313 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 172 PRGVGFANNCPSASEGTLTTQEQLFRE*STTGSESRP 282 P GF +N + S T TT E + TTG E++P Sbjct: 144 PLPAGFFDNQKTDSSNTKTTSEPKQSQTQTTGPETKP 180 >At3g02860.1 68416.m00278 expressed protein Length = 312 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 172 PRGVGFANNCPSASEGTLTTQEQLFRE*STTGSESRP 282 P GF +N + S T TT E + TTG E++P Sbjct: 143 PLPAGFFDNQKTDSSNTKTTSEPKQSQTQTTGPETKP 179 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,187,123 Number of Sequences: 28952 Number of extensions: 267345 Number of successful extensions: 587 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 587 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -