BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0581 (694 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.01 |cox1||cytochrome c oxidase 1|Schizosaccharomyces pombe... 71 1e-13 SPAC222.14c |||GTP binding protein Sey1 |Schizosaccharomyces pom... 25 7.9 >SPMIT.01 |cox1||cytochrome c oxidase 1|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 537 Score = 71.3 bits (167), Expect = 1e-13 Identities = 31/55 (56%), Positives = 38/55 (69%) Frame = +3 Query: 516 AVGITAFXXXXXXXXXAGAITILLTDRNLNTSFFDPAGGGDPILYQHLF*FFGHP 680 A+ IT+ AG + +L +DRNLNTSF+ P GGGDP+LYQHLF FFGHP Sbjct: 194 AIMITSILLLLTLPVLAGGLFMLFSDRNLNTSFYAPEGGGDPVLYQHLFWFFGHP 248 Score = 53.6 bits (123), Expect = 3e-08 Identities = 29/72 (40%), Positives = 38/72 (52%), Gaps = 2/72 (2%) Frame = +2 Query: 77 ELGNPGS--LIGDDQIYNTIVTAHAXXXXXXXXXXXXXXXXXN*LVPLILGAPDIAFPRI 250 EL PGS L G+ Q+YN ++AH N LVPL++GAPD+A+PR+ Sbjct: 45 ELSAPGSQFLSGNGQLYNVAISAHGILMIFFFIIPALFGAFGNYLVPLMIGAPDVAYPRV 104 Query: 251 NI*DFDSYPPPL 286 N F PP L Sbjct: 105 NNFTFWLLPPAL 116 Score = 52.4 bits (120), Expect = 6e-08 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = +1 Query: 307 IVENGAGTG*TVYPPLSSNIAHRGRSVDLAIFSLHLAGISS 429 + E G G G TVYPPLSS +H G ++DLAI SL L GISS Sbjct: 124 LTEEGPGGGWTVYPPLSSITSHSGPAIDLAILSLQLTGISS 164 >SPAC222.14c |||GTP binding protein Sey1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 762 Score = 25.4 bits (53), Expect = 7.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 267 TPTPLPYIINFKKNCRKWCRNRMNS 341 T T YIINFKKN + R +++S Sbjct: 512 TKTTEEYIINFKKNSWLFFRKKIDS 536 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,230,219 Number of Sequences: 5004 Number of extensions: 37403 Number of successful extensions: 92 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 321951680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -