BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0580 (696 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 24 1.0 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 24 1.0 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 24 1.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.8 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 4.2 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 22 5.5 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 9.6 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 24.2 bits (50), Expect = 1.0 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -3 Query: 232 SEAASNRPDPAQEMPELDGRPIRREVR 152 S A P P QE+P+L+ +P+ ++ Sbjct: 245 SHPAIVTPGPKQELPDLNHKPLNLTIK 271 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 24.2 bits (50), Expect = 1.0 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -3 Query: 232 SEAASNRPDPAQEMPELDGRPIRREVR 152 S A P P QE+P+L+ +P+ ++ Sbjct: 137 SHPAIVTPGPKQELPDLNHKPLNLTIK 163 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = +3 Query: 249 SRGPQCEVCCMGLPPLGRSW*ATGEVGARGRP 344 S G +GLP GR+W E G P Sbjct: 285 SNGAPSAKIVLGLPTFGRAWAMDDESDINGTP 316 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 1.8 Identities = 11/38 (28%), Positives = 15/38 (39%) Frame = +3 Query: 6 PQQMIAGLGTTAAWRP*S*EETRRSPPWRW*PGVKGSS 119 P Q + TT +W P S P W P + +S Sbjct: 1345 PAQSTTSVSTTTSWNPGSTTNYPEWQPTEWHPPIPPTS 1382 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.2 bits (45), Expect = 4.2 Identities = 10/24 (41%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = +1 Query: 508 PPPAPQS-RTSTGTTPVVHPGHSP 576 PPPAPQS T ++ + P +P Sbjct: 11 PPPAPQSAATPISSSGMTSPAAAP 34 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 48 ARPPSSPNQQ 19 A PP SPNQQ Sbjct: 33 ATPPQSPNQQ 42 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.0 bits (42), Expect = 9.6 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +1 Query: 511 PPAPQSRTSTGTTPVVHPGHSPSG 582 P S + G PV P HSP G Sbjct: 179 PLISSSSSPPGVFPVDAPMHSPPG 202 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,952 Number of Sequences: 336 Number of extensions: 3964 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -