BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0578 (698 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38755| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_28937| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-08) 28 6.3 >SB_38755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 471 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +3 Query: 390 LVFLTNISERNLISNFNKFTVINCHNYLFNLYVFKHNNN 506 ++ NI+ N+I N N +IN N + N+ + +NNN Sbjct: 405 IIINNNINNNNIIINNNNIIIIN--NNIININIIINNNN 441 >SB_28937| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-08) Length = 1258 Score = 28.3 bits (60), Expect = 6.3 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = +3 Query: 423 LISNFNKFTVINCHNYLFNLYVFKHNNNKNKLYFILIRYTF-FPTYNNITNVLYLQKKGD 599 LI + VI L F+H KNK YFI I + F + +I N+ Y + + Sbjct: 90 LIGSVLSLMVIAMERAYAALVPFRHRLLKNKTYFIGIALIWIFASLTSIDNISYSKSTHN 149 Query: 600 NPISN 614 N + + Sbjct: 150 NALQH 154 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,493,586 Number of Sequences: 59808 Number of extensions: 380685 Number of successful extensions: 854 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 852 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1829596184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -