BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0576 (644 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC713.02c |ubp21|ubpD, ubp15|ubiquitin C-terminal hydrolase Ub... 25 7.1 SPAC4G9.14 |||Mvp17/PMP22 family|Schizosaccharomyces pombe|chr 1... 25 9.3 >SPBC713.02c |ubp21|ubpD, ubp15|ubiquitin C-terminal hydrolase Ubp21|Schizosaccharomyces pombe|chr 2|||Manual Length = 1129 Score = 25.4 bits (53), Expect = 7.1 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +3 Query: 54 LNSENYKVLKNIIVHRSKEIIEQNNENYCSAV*HFLSL 167 L ++NY+ + N +VH ++ E + +Y V +F +L Sbjct: 27 LRADNYEEIYNSLVHHEPDLEEAAHASYSWVVKNFSTL 64 >SPAC4G9.14 |||Mvp17/PMP22 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 221 Score = 25.0 bits (52), Expect = 9.3 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -1 Query: 137 IIFVILFYYFFTSMYND 87 ++ +LF++FF S +ND Sbjct: 11 LLICVLFFFFFVSRFND 27 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,874,874 Number of Sequences: 5004 Number of extensions: 29503 Number of successful extensions: 70 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -