BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0575 (633 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 26 0.23 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 2.8 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 22 4.9 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 4.9 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 8.6 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 26.2 bits (55), Expect = 0.23 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -1 Query: 144 PSPSSNGTNSYTPAGQNLASGPSYTPRLVLTGTVS 40 PSPSS T S P + S P+Y+ R V+T S Sbjct: 75 PSPSS--TPSSLPTQRTSTSNPTYSSRSVMTSCSS 107 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/46 (19%), Positives = 24/46 (52%) Frame = +2 Query: 119 FVPLEEGDGQRLQINAQNCIHCKTCDIKDPSQNINWVVPEGGGGPA 256 F+ ++E + L ++ + TC ++P +++ +V + GP+ Sbjct: 625 FLKVKENEITLLVATVRHVMAPSTCQPQNPDNDVHSIVDDSDVGPS 670 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 21.8 bits (44), Expect = 4.9 Identities = 12/52 (23%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Frame = +2 Query: 65 LGVYDGPEARFCPAGVYEFV----PLEEGDGQRLQINAQNCIHCKTCDIKDP 208 + + + PE R G+YE++ P + Q Q + ++ + C +K P Sbjct: 94 MAIRNSPEKRLTLNGIYEYIMRNFPYYRENKQGWQNSIRHNLSLNKCFVKVP 145 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.8 bits (44), Expect = 4.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 385 NSLQLKRHVLLENSSKIFNSEE 450 +S QLK HVL+ + K F ++ Sbjct: 230 DSNQLKAHVLIHTNEKPFECDK 251 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.0 bits (42), Expect = 8.6 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 116 RIHLQDKTWLRVHR 75 ++HLQD T +HR Sbjct: 70 KVHLQDNTIEMIHR 83 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,502 Number of Sequences: 336 Number of extensions: 2842 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16292796 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -