Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0570
         (647 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc...    29   3.5  

>At2g41500.1 68415.m05127 WD-40 repeat family protein / small
           nuclear ribonucleoprotein Prp4p-related similar to U4/U6
           small nuclear ribonucleoprotein hPrp4 (GP:2708305) {Homo
           sapiens}; contains Pfam PF00400: WD domain, G-beta
           repeat (7 copies)|19877698|gb|AU238529.1|AU238529
          Length = 554

 Score = 28.7 bits (61), Expect = 3.5
 Identities = 16/43 (37%), Positives = 21/43 (48%)
 Frame = +3

Query: 336 GLQNLQLY*DLRTHLKVAVGSGLVLPLALLKSMGNGNHSPSGG 464
           GL +L    DLRT   + V  G + P+  +    NG H  SGG
Sbjct: 400 GLDSLARVWDLRTGRSILVFQGHIKPVFSVNFSPNGYHLASGG 442


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,891,280
Number of Sequences: 28952
Number of extensions: 263578
Number of successful extensions: 567
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 557
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 567
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1344285648
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)