BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0567 (619 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 27 0.17 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 23 2.7 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 22 3.6 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 6.3 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 6.3 AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 21 8.3 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 26.6 bits (56), Expect = 0.17 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = +3 Query: 273 SSNAFRFEGRGSRCNYTEILEFISQSGWRI 362 + N+ ++ G Y EI+E + GW++ Sbjct: 284 AGNSGKYTGEAGMLGYNEIVELQKEGGWKV 313 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +1 Query: 586 VRGFLFALICD 618 + GFLF LICD Sbjct: 13 IAGFLFLLICD 23 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 22.2 bits (45), Expect = 3.6 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +3 Query: 279 NAFRFEGRGSRCNYTEILEFISQSGW 356 +A R+ G Y EI+E + GW Sbjct: 290 DAGRYTGERGMMGYNEIVEAQNAGGW 315 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 6.3 Identities = 6/18 (33%), Positives = 11/18 (61%) Frame = -2 Query: 261 IGRRWYLPARTHKTSYHQ 208 +GRRW+ R + Y++ Sbjct: 513 LGRRWHALGREEQAKYYE 530 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 6.3 Identities = 6/18 (33%), Positives = 11/18 (61%) Frame = -2 Query: 261 IGRRWYLPARTHKTSYHQ 208 +GRRW+ R + Y++ Sbjct: 405 LGRRWHALGREEQAKYYE 422 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 21.0 bits (42), Expect = 8.3 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -3 Query: 395 WLLEPIDIYNVNAPPTLRYK 336 WL P + N P +LR+K Sbjct: 7 WLTPPHSLGNTVTPVSLRFK 26 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,459 Number of Sequences: 336 Number of extensions: 2633 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -