BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0567 (619 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0421 - 22756903-22757384,22757585-22758047 29 3.0 10_08_0777 + 20489528-20490649 27 9.0 >02_04_0421 - 22756903-22757384,22757585-22758047 Length = 314 Score = 29.1 bits (62), Expect = 3.0 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -2 Query: 552 RDVN*KENH*AIDTNQLL*EQQKKSHMHYITKKK 451 RDVN + NH + N ++ + SHM+Y T ++ Sbjct: 254 RDVNYRHNHPLYNNNPIVQKHPSFSHMYYATNRE 287 >10_08_0777 + 20489528-20490649 Length = 373 Score = 27.5 bits (58), Expect = 9.0 Identities = 16/52 (30%), Positives = 23/52 (44%) Frame = +1 Query: 301 GAAVVTIPRS*NLYLKVGGAFTL*MSMGSSNHLTTSWDVSSSTHLSNKIYFF 456 GAA +T+P S +Y G L M + +LTT + H N + F Sbjct: 304 GAAALTVPPSKYMYDAGNGTVCLAMMSSAMLNLTTELSILGRLHQENIHFLF 355 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,902,553 Number of Sequences: 37544 Number of extensions: 271730 Number of successful extensions: 581 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 581 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1490248872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -