BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0559 (635 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual 27 2.3 SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces... 27 3.0 SPAPB1A10.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 6.9 SPBC25B2.07c |mug164||microtubule-associated protein|Schizosacch... 25 9.1 >SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1236 Score = 27.1 bits (57), Expect = 2.3 Identities = 25/104 (24%), Positives = 49/104 (47%), Gaps = 2/104 (1%) Frame = +2 Query: 59 SNELIDSSPTSIARISSTLIVTRTTSQDVYTCLXXXXXXXXXXXXVVYNTDSATELSERA 238 S+ ++ SS +S +S+++ VT + + V + V TDSAT S A Sbjct: 877 SSSVVSSSLSSTTSLSTSIPVTSSVAPAVTST------GSETSSVVGSGTDSATSSSWTA 930 Query: 239 KLFPLSLASW--SPIAPTWTTSATGWCSRAASRDTPSPRSPGST 364 + ++ S + + PT ++SA+ W S + + + + GS+ Sbjct: 931 ETSSSAITSSVAASVTPTSSSSASSWSSSSEVDPSTAASATGSS 974 >SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3131 Score = 26.6 bits (56), Expect = 3.0 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +2 Query: 203 NTDSATELSERAKLFPLSLASWSPIAPTWTTSAT 304 N + T L+ F + + W P+ WT S T Sbjct: 1663 NLSATTSLTLHCNAFNFAKSHWEPVIEPWTFSTT 1696 >SPAPB1A10.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 412 Score = 25.4 bits (53), Expect = 6.9 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = -3 Query: 606 TNLSNRTSILSIHDAFGSSSFFLSSTRV*RGRRCFSL 496 + LSN+ ++ S D F SSS L + V RG CF L Sbjct: 81 STLSNKKTLKSQLDRFLSSSKKLHNDDVNRGDYCFLL 117 >SPBC25B2.07c |mug164||microtubule-associated protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 501 Score = 25.0 bits (52), Expect = 9.1 Identities = 18/57 (31%), Positives = 27/57 (47%) Frame = +2 Query: 320 AASRDTPSPRSPGSTDRMCPLKRTRA*RCFARASWSYPPSSGATWTSTLAKPKTLSA 490 A S D+P +SPGS D+ R R +S PP+ +T T L++ +A Sbjct: 203 AKSDDSPVVKSPGSNDKPSASPRISV-RSLGNSSVVRPPTRTST-TRPLSRVNVTNA 257 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,373,584 Number of Sequences: 5004 Number of extensions: 45471 Number of successful extensions: 127 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 127 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 283719918 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -