Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= prgv0558
         (430 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK127397-1|BAC86958.1|  130|Homo sapiens protein ( Homo sapiens ...    29   5.1  

>AK127397-1|BAC86958.1|  130|Homo sapiens protein ( Homo sapiens
           cDNA FLJ45488 fis, clone BRTHA2003759. ).
          Length = 130

 Score = 29.5 bits (63), Expect = 5.1
 Identities = 13/47 (27%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
 Frame = -2

Query: 411 FILFYLHNIFLFANLGLY-YFFNYHKICIFLIFFVIIQISLILYVSV 274
           FI  Y++ ++++  L +Y Y F Y  + IF+  ++ + I L +Y+ +
Sbjct: 22  FIYIYIY-VYVYIYLYIYFYIFTYIYLYIFIYIYICLYIYLYIYLYI 67


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 48,520,070
Number of Sequences: 237096
Number of extensions: 846741
Number of successful extensions: 1677
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1643
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1676
length of database: 76,859,062
effective HSP length: 83
effective length of database: 57,180,094
effective search space used: 3373625546
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)