BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0557 (635 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 27 0.13 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 26 0.23 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 2.8 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 21 8.6 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 21 8.6 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 27.1 bits (57), Expect = 0.13 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = +1 Query: 349 FYDHSPFNLTYVKKGKRSRNTTVALKEARA*RAKFKLH 462 +Y H P TY GK + T L + R R + H Sbjct: 226 WYQHQPLLFTYTDDGKNQQRTGTELTKMRPKRQSSRRH 263 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 26.2 bits (55), Expect = 0.23 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -3 Query: 138 HTAHLMVSGYHRPWTSTMPGAEPSGTI 58 +T H+ G+H P+T M G E S + Sbjct: 486 YTIHMGYHGFHNPFTCNMCGVECSDKV 512 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 2.8 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 102 GDGNHSPSSGPCARTSA 152 G GN+ P GP + SA Sbjct: 530 GSGNNQPPGGPSSHVSA 546 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 21.0 bits (42), Expect = 8.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +1 Query: 313 LVSQLNSAGFNSFYDH 360 L+ Q+ F+SF+DH Sbjct: 45 LIKQIGVKEFDSFHDH 60 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.0 bits (42), Expect = 8.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -2 Query: 130 PLDGEWLPSPMDFNNA 83 PLDGEW ++ N++ Sbjct: 221 PLDGEWQRDNLNANSS 236 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,159 Number of Sequences: 336 Number of extensions: 2963 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16397237 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -