BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0557 (635 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding prote... 25 0.81 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 2.5 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 3.3 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 3.3 AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding prote... 22 4.3 >AF393492-1|AAL60417.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 24.6 bits (51), Expect = 0.81 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -3 Query: 486 VYKRDQKEVQFKFGTLRACLFQ 421 +Y+ + +E KFG AC+FQ Sbjct: 40 MYEANSEEQMKKFGCFEACVFQ 61 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.0 bits (47), Expect = 2.5 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 392 PFLTYVRLNGLWS 354 PF YV +NG WS Sbjct: 241 PFAVYVLVNGSWS 253 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -3 Query: 231 KELNKELNNLQYLEIMRDDSKVFFLPLQTY 142 ++ + +NN LE R+D K F + ++ Y Sbjct: 464 EQFDTTINNGLLLEEQRNDDKPFLIKIRQY 493 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.6 bits (46), Expect = 3.3 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -3 Query: 231 KELNKELNNLQYLEIMRDDSKVFFLPLQTY 142 ++ + +NN LE R+D K F + ++ Y Sbjct: 464 EQFDTTINNGLLLEEQRNDDKPFLIKIRQY 493 >AF393495-1|AAL60420.1| 136|Apis mellifera odorant binding protein ASP4 protein. Length = 136 Score = 22.2 bits (45), Expect = 4.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 486 VYKRDQKEVQFKFGTLRACLFQ 421 +Y+ + +E K G AC+FQ Sbjct: 40 MYESNSEEQMKKLGCFEACVFQ 61 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,496 Number of Sequences: 438 Number of extensions: 3427 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -