BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0556 (641 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC26A3.11 |||amidohydrolase|Schizosaccharomyces pombe|chr 1|||... 27 3.0 SPAC2F3.17c |lsm6||U6 snRNP-associated protein Lsm6|Schizosaccha... 25 7.0 SPAC16C9.04c |||CCR4-Not complex subunit Mot2 |Schizosaccharomyc... 25 9.3 >SPAC26A3.11 |||amidohydrolase|Schizosaccharomyces pombe|chr 1|||Manual Length = 322 Score = 26.6 bits (56), Expect = 3.0 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -3 Query: 531 CTVKILQPLINISVGRLDFKLLTKRHVFDKQVNINIC 421 C+V I N+S G L ++LL + D ++ + C Sbjct: 212 CSVMIYPGAFNLSTGPLHWELLARARAVDNEMFVACC 248 >SPAC2F3.17c |lsm6||U6 snRNP-associated protein Lsm6|Schizosaccharomyces pombe|chr 1|||Manual Length = 75 Score = 25.4 bits (53), Expect = 7.0 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 443 LSKTCLFVNNLKSNLPTDIFIKGCSILTV 529 L +T +VN K+N+ D FI+G ++L V Sbjct: 42 LERTEEYVNGKKTNVYGDAFIRGNNVLYV 70 >SPAC16C9.04c |||CCR4-Not complex subunit Mot2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 489 Score = 25.0 bits (52), Expect = 9.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -1 Query: 584 HPNLSYSHQLKTNDYATFVQSKYCS 510 HP +S + L TN+ AT V + Y S Sbjct: 299 HPQVSMTPSLSTNNTATSVPAPYSS 323 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,099,920 Number of Sequences: 5004 Number of extensions: 13436 Number of successful extensions: 20 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -