BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0555 (620 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 8.3 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 21 8.3 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.0 bits (42), Expect = 8.3 Identities = 7/35 (20%), Positives = 22/35 (62%) Frame = +2 Query: 8 CVVRQNLL*ISKLFIENCNVIFISVLGYKEIIVIM 112 C++ +NL+ + + N ++ IS+ K++++++ Sbjct: 258 CIIAKNLMSNAATLVLNKHIDNISLRARKQVVLML 292 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 21.0 bits (42), Expect = 8.3 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 362 ISLSDGIYECLDN*HTRHGLMTDTIANPGALVT 264 +S Y CL T+ +++DT+ N +VT Sbjct: 183 VSTDAFFYTCLIQIETQCEIVSDTLRNLDKIVT 215 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,680 Number of Sequences: 336 Number of extensions: 2969 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15875032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -