BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0548 (631 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000DD8576 Cluster: PREDICTED: similar to CG13722-PA... 33 7.5 UniRef50_Q9HHA6 Cluster: Putative uncharacterized protein; n=2; ... 32 9.9 >UniRef50_UPI0000DD8576 Cluster: PREDICTED: similar to CG13722-PA; n=1; Homo sapiens|Rep: PREDICTED: similar to CG13722-PA - Homo sapiens Length = 329 Score = 32.7 bits (71), Expect = 7.5 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -2 Query: 123 FIGLYIPIPTFRHPMIPTSVLRHE 52 F LY+P PTF H +P S L H+ Sbjct: 97 FTHLYLPAPTFTHQYLPVSTLAHQ 120 >UniRef50_Q9HHA6 Cluster: Putative uncharacterized protein; n=2; Methanomicrobia|Rep: Putative uncharacterized protein - Methanosarcina thermophila Length = 180 Score = 32.3 bits (70), Expect = 9.9 Identities = 12/30 (40%), Positives = 21/30 (70%) Frame = -1 Query: 622 NLLLSKKLKKYERNESQDFRYLFFMFYCFV 533 N ++ K LKK +RNE+ +R+L + +CF+ Sbjct: 127 NQMIKKILKKIQRNEAGFYRFLHWFLHCFL 156 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 483,388,720 Number of Sequences: 1657284 Number of extensions: 7902628 Number of successful extensions: 14709 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14242 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14702 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 46466611856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -