BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0547 (626 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1834.01 |sup45||translation release factor eRF1|Schizosaccha... 27 2.9 SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pomb... 26 3.9 SPAC20G8.10c ||SPAC3A12.01c|beclin family protein|Schizosaccharo... 25 6.8 >SPAC1834.01 |sup45||translation release factor eRF1|Schizosaccharomyces pombe|chr 1|||Manual Length = 433 Score = 26.6 bits (56), Expect = 2.9 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = -3 Query: 162 LNIDFEPLSTVNTS---CNMKILVQTVKNL 82 LNIDFEP +NTS C+ K + + L Sbjct: 107 LNIDFEPFKPINTSQYLCDNKFHTEALAEL 136 >SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1283 Score = 26.2 bits (55), Expect = 3.9 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = -3 Query: 168 STLNIDFEPLSTVNTSCNMKILVQTVKNLNTNFYSSKLSLQPGGSTSLRAAATSI 4 STL I +PL NTS + T +N NT +++SL G +T+ + S+ Sbjct: 86 STLTISSQPLIHTNTSISKPSQTATPQNTNT----TQVSLTNGTTTNSYSNTNSL 136 >SPAC20G8.10c ||SPAC3A12.01c|beclin family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 464 Score = 25.4 bits (53), Expect = 6.8 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -3 Query: 132 VNTSCNMKILVQTVKNLNTNFYSSKLSLQPGGSTS 28 +N + M +L+ V +F+SS L+P GS S Sbjct: 317 INAAWGMTVLLLDVLTEKLDFHSSSYQLKPFGSQS 351 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,236,441 Number of Sequences: 5004 Number of extensions: 41647 Number of successful extensions: 85 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 277683324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -