BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0547 (626 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 39 0.003 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 39 0.004 SB_26310| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 38 0.005 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_29878| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 38 0.005 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_39773| Best HMM Match : DUF765 (HMM E-Value=4.1) 38 0.007 SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_2222| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.007 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 38 0.009 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 38 0.009 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 38 0.009 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 38 0.009 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 38 0.009 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 38 0.009 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 38 0.009 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_23941| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_22547| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 38 0.009 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_6274| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_2526| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_876| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 37 0.012 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_42492| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_18514| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 37 0.015 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 36 0.020 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 36 0.020 SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) 36 0.020 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_26132| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_23020| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 36 0.027 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 36 0.027 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 36 0.027 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 36 0.027 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 36 0.027 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 36 0.027 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 36 0.027 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 36 0.027 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 36 0.027 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 36 0.027 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 36 0.027 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 36 0.027 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 36 0.027 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 36 0.027 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 36 0.027 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 36 0.027 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 36 0.027 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 36 0.027 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 36 0.027 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 36 0.027 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 36 0.027 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 36 0.027 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 36 0.027 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 36 0.027 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 36 0.027 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 36 0.027 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 36 0.027 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 36 0.027 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 36 0.027 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 36 0.027 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 36 0.027 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 36 0.027 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 36 0.027 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 36 0.027 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 36 0.027 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 36 0.027 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_42545| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 36 0.027 SB_42077| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_41224| Best HMM Match : DUF765 (HMM E-Value=3.5) 36 0.027 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_40885| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 36 0.027 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 36 0.027 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 36 0.027 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_37896| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_37019| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_36228| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 36 0.027 SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) 36 0.027 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.027 >SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 40.7 bits (91), Expect = 0.001 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = -1 Query: 65 HPNCPCSPGDPLV*ERPPPR 6 HP+ CSPGDPLV ERPPPR Sbjct: 7 HPSNSCSPGDPLVLERPPPR 26 >SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 68 IHPNCPCSPGDPLV*ERPPPR 6 I+P+ CSPGDPLV ERPPPR Sbjct: 20 IYPSNSCSPGDPLVLERPPPR 40 >SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 71 FIHPNCPCSPGDPLV*ERPPPR 6 F H + CSPGDPLV ERPPPR Sbjct: 4 FFHASNSCSPGDPLVLERPPPR 25 >SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 39.9 bits (89), Expect = 0.002 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -1 Query: 77 PIFIHPNCPCSPGDPLV*ERPPPR 6 P+ +P+ CSPGDPLV ERPPPR Sbjct: 5 PLESYPSNSCSPGDPLVLERPPPR 28 >SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 71 FIHPNCPCSPGDPLV*ERPPPR 6 F P+ CSPGDPLV ERPPPR Sbjct: 16 FFSPSNSCSPGDPLVLERPPPR 37 >SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -1 Query: 74 IFIHPNCPCSPGDPLV*ERPPPR 6 +F P+ CSPGDPLV ERPPPR Sbjct: 10 MFTDPSNSCSPGDPLVLERPPPR 32 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -1 Query: 71 FIHPNCPCSPGDPLV*ERPPPR 6 F+ P+ CSPGDPLV ERPPPR Sbjct: 20 FLLPSNSCSPGDPLVLERPPPR 41 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 39.5 bits (88), Expect = 0.002 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = -1 Query: 80 IPIFIHPNCPCSPGDPLV*ERPPPR 6 +P + + + CSPGDPLV ERPPPR Sbjct: 21 VPFYCYVSNSCSPGDPLVLERPPPR 45 >SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 77 PIFIHPNCPCSPGDPLV*ERPPPR 6 P + P+ CSPGDPLV ERPPPR Sbjct: 50 PPHLSPSNSCSPGDPLVLERPPPR 73 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = -1 Query: 77 PIFIHPNCPCSPGDPLV*ERPPPR 6 PIF + CSPGDPLV ERPPPR Sbjct: 42 PIFKPTSNSCSPGDPLVLERPPPR 65 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 38.7 bits (86), Expect = 0.004 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 68 IHPNCPCSPGDPLV*ERPPPR 6 +H + CSPGDPLV ERPPPR Sbjct: 32 VHASNSCSPGDPLVLERPPPR 52 >SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) Length = 294 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -1 Query: 68 IHPNCPCSPGDPLV*ERPPPR 6 IH + CSPGDPLV ERPPPR Sbjct: 4 IHGSNSCSPGDPLVLERPPPR 24 >SB_26310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 38.7 bits (86), Expect = 0.004 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 77 PIFIHPNCPCSPGDPLV*ERPPPR 6 PI + + CSPGDPLV ERPPPR Sbjct: 3 PIQVQTSNSCSPGDPLVLERPPPR 26 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 38.7 bits (86), Expect = 0.004 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -1 Query: 77 PIFIHPNCPCSPGDPLV*ERPPPR 6 P+F+ N CSPGDPLV ERPPPR Sbjct: 18 PLFLISNS-CSPGDPLVLERPPPR 40 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 38.3 bits (85), Expect = 0.005 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -1 Query: 68 IHPNCPCSPGDPLV*ERPPPR 6 I P+ CSPGDPLV ERPPPR Sbjct: 181 IPPSNSCSPGDPLVLERPPPR 201 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 38.3 bits (85), Expect = 0.005 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -1 Query: 74 IFIHPNCPCSPGDPLV*ERPPPR 6 + + P+ CSPGDPLV ERPPPR Sbjct: 13 LHVPPSNSCSPGDPLVLERPPPR 35 >SB_13284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 38.3 bits (85), Expect = 0.005 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = -3 Query: 168 STLNIDFEPLSTVNTSCNMKILVQTVKNLNTNFYSSKLS-LQPGGSTSLRAAATSID 1 S + ++F L N + + I N T F ++++ LQPGGSTS RAAAT+++ Sbjct: 18 SQIAVEFSKLRQPNIAKSAPIRDSLSNNEQTRFLNNQIEFLQPGGSTSSRAAATAVE 74 >SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 38.3 bits (85), Expect = 0.005 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -1 Query: 80 IPIFIHPNCPCSPGDPLV*ERPPPR 6 +P+ I + CSPGDPLV ERPPPR Sbjct: 13 VPLTILGSNSCSPGDPLVLERPPPR 37 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 38.3 bits (85), Expect = 0.005 Identities = 17/27 (62%), Positives = 19/27 (70%), Gaps = 4/27 (14%) Frame = -1 Query: 74 IFIHPNC----PCSPGDPLV*ERPPPR 6 +F+ NC CSPGDPLV ERPPPR Sbjct: 12 LFVQGNCMKSNSCSPGDPLVLERPPPR 38 >SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 38.3 bits (85), Expect = 0.005 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 71 FIHPNCPCSPGDPLV*ERPPPR 6 + P+ CSPGDPLV ERPPPR Sbjct: 41 YAEPSNSCSPGDPLVLERPPPR 62 >SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 38.3 bits (85), Expect = 0.005 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 68 IHPNCPCSPGDPLV*ERPPPR 6 + P+ CSPGDPLV ERPPPR Sbjct: 5 LEPSNSCSPGDPLVLERPPPR 25 >SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 38.3 bits (85), Expect = 0.005 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 68 IHPNCPCSPGDPLV*ERPPPR 6 + P+ CSPGDPLV ERPPPR Sbjct: 7 VKPSNSCSPGDPLVLERPPPR 27 >SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 38.3 bits (85), Expect = 0.005 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 68 IHPNCPCSPGDPLV*ERPPPR 6 +H + CSPGDPLV ERPPPR Sbjct: 14 LHASNSCSPGDPLVLERPPPR 34 >SB_29878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.3 bits (85), Expect = 0.005 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 68 IHPNCPCSPGDPLV*ERPPPR 6 +H + CSPGDPLV ERPPPR Sbjct: 4 LHSSNSCSPGDPLVLERPPPR 24 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 38.3 bits (85), Expect = 0.005 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 80 IPIFIHPNCPCSPGDPLV*ERPPPR 6 +P P+ CSPGDPLV ERPPPR Sbjct: 509 VPSSSTPSNSCSPGDPLVLERPPPR 533 Score = 30.7 bits (66), Expect = 1.0 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 44 PGDPLV*ERPPPR 6 PGDPLV ERPPPR Sbjct: 664 PGDPLVLERPPPR 676 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 65 HPNCPCSPGDPLV*ERPPPR 6 +P+ CSPGDPLV ERPPPR Sbjct: 62 NPSNSCSPGDPLVLERPPPR 81 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 68 IHPNCPCSPGDPLV*ERPPPR 6 +H + CSPGDPLV ERPPPR Sbjct: 14 VHISNSCSPGDPLVLERPPPR 34 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 68 IHPNCPCSPGDPLV*ERPPPR 6 +H + CSPGDPLV ERPPPR Sbjct: 3 LHVSNSCSPGDPLVLERPPPR 23 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 68 IHPNCPCSPGDPLV*ERPPPR 6 +H + CSPGDPLV ERPPPR Sbjct: 5 LHVSNSCSPGDPLVLERPPPR 25 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 37.9 bits (84), Expect = 0.007 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -1 Query: 68 IHPNCPCSPGDPLV*ERPPPR 6 I P+ CSPGDPLV ERPPPR Sbjct: 64 ILPSNSCSPGDPLVLERPPPR 84 >SB_39773| Best HMM Match : DUF765 (HMM E-Value=4.1) Length = 126 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 68 IHPNCPCSPGDPLV*ERPPPR 6 +H + CSPGDPLV ERPPPR Sbjct: 1 MHSSNSCSPGDPLVLERPPPR 21 >SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 65 HPNCPCSPGDPLV*ERPPPR 6 +P+ CSPGDPLV ERPPPR Sbjct: 74 NPSNSCSPGDPLVLERPPPR 93 >SB_2222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 68 IHPNCPCSPGDPLV*ERPPPR 6 +H + CSPGDPLV ERPPPR Sbjct: 1 MHESNSCSPGDPLVLERPPPR 21 >SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.9 bits (84), Expect = 0.007 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -1 Query: 74 IFIHPNCPCSPGDPLV*ERPPPR 6 I ++ + CSPGDPLV ERPPPR Sbjct: 13 IIVYTSNSCSPGDPLVLERPPPR 35 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 26 PSNSCSPGDPLVLERPPPR 44 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 26 PSNSCSPGDPLVLERPPPR 44 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 65 HPNCPCSPGDPLV*ERPPPR 6 H + CSPGDPLV ERPPPR Sbjct: 12 HTSNSCSPGDPLVLERPPPR 31 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 20 PSNSCSPGDPLVLERPPPR 38 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 42 PSNSCSPGDPLVLERPPPR 60 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 17 PSNSCSPGDPLVLERPPPR 35 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 19 PSNSCSPGDPLVLERPPPR 37 >SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 8 PSNSCSPGDPLVLERPPPR 26 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 56 PSNSCSPGDPLVLERPPPR 74 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 156 PSNSCSPGDPLVLERPPPR 174 >SB_14086| Best HMM Match : POR (HMM E-Value=7.7) Length = 292 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 168 PSNSCSPGDPLVLERPPPR 186 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 20 PSNSCSPGDPLVLERPPPR 38 >SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) Length = 593 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 136 PSNSCSPGDPLVLERPPPR 154 >SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) Length = 141 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 65 HPNCPCSPGDPLV*ERPPPR 6 H + CSPGDPLV ERPPPR Sbjct: 16 HSSNSCSPGDPLVLERPPPR 35 >SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) Length = 129 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 5 PSNSCSPGDPLVLERPPPR 23 >SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 28 PSNSCSPGDPLVLERPPPR 46 >SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 7 PSNSCSPGDPLVLERPPPR 25 >SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 68 IHPNCPCSPGDPLV*ERPPPR 6 +H + CSPGDPLV ERPPPR Sbjct: 1 MHRSNSCSPGDPLVLERPPPR 21 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 40 PSNSCSPGDPLVLERPPPR 58 >SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 14 PSNSCSPGDPLVLERPPPR 32 >SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 111 PSNSCSPGDPLVLERPPPR 129 >SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 35 PSNSCSPGDPLVLERPPPR 53 >SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 14 PSNSCSPGDPLVLERPPPR 32 >SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 46 PSNSCSPGDPLVLERPPPR 64 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 13 PSNSCSPGDPLVLERPPPR 31 >SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 19 PSNSCSPGDPLVLERPPPR 37 >SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 65 HPNCPCSPGDPLV*ERPPPR 6 H + CSPGDPLV ERPPPR Sbjct: 10 HKSNSCSPGDPLVLERPPPR 29 >SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 37.5 bits (83), Expect = 0.009 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = -1 Query: 80 IPIFIHPNCPCSPGDPLV*ERPPPR 6 IP + + CSPGDPLV ERPPPR Sbjct: 85 IPPSVSTSNSCSPGDPLVLERPPPR 109 >SB_23941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 65 HPNCPCSPGDPLV*ERPPPR 6 H + CSPGDPLV ERPPPR Sbjct: 6 HTSNSCSPGDPLVLERPPPR 25 >SB_22547| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 7 PSNSCSPGDPLVLERPPPR 25 >SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 45 PSNSCSPGDPLVLERPPPR 63 >SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 20 PSNSCSPGDPLVLERPPPR 38 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 72 PSNSCSPGDPLVLERPPPR 90 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 97 PSNSCSPGDPLVLERPPPR 115 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 29 PSNSCSPGDPLVLERPPPR 47 >SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 65 HPNCPCSPGDPLV*ERPPPR 6 H + CSPGDPLV ERPPPR Sbjct: 49 HTSNSCSPGDPLVLERPPPR 68 >SB_6274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 3 PSNSCSPGDPLVLERPPPR 21 >SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 14 PSNSCSPGDPLVLERPPPR 32 >SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 14 PSNSCSPGDPLVLERPPPR 32 >SB_2526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 65 HPNCPCSPGDPLV*ERPPPR 6 H + CSPGDPLV ERPPPR Sbjct: 44 HTSNSCSPGDPLVLERPPPR 63 >SB_876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 19 PSNSCSPGDPLVLERPPPR 37 >SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 37.5 bits (83), Expect = 0.009 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = -1 Query: 62 PNCPCSPGDPLV*ERPPPR 6 P+ CSPGDPLV ERPPPR Sbjct: 71 PSNSCSPGDPLVLERPPPR 89 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 37.1 bits (82), Expect = 0.012 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -1 Query: 74 IFIHPNCPCSPGDPLV*ERPPPR 6 IF N CSPGDPLV ERPPPR Sbjct: 13 IFFRSNS-CSPGDPLVLERPPPR 34 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 37.1 bits (82), Expect = 0.012 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +2 Query: 2 SIEVAAALRLVDPPGCRDNLDE 67 S VAAAL LVDPPGCR+++D+ Sbjct: 6 STAVAAALELVDPPGCRNSMDD 27 >SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.1 bits (82), Expect = 0.012 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = -1 Query: 80 IPIFIHPNCPCSPGDPLV*ERPPPR 6 + +F + CSPGDPLV ERPPPR Sbjct: 6 VGLFYSASNSCSPGDPLVLERPPPR 30 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.1 bits (82), Expect = 0.012 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 65 HPNCPCSPGDPLV*ERPPPR 6 H + CSPGDPLV ERPPPR Sbjct: 3 HVSNSCSPGDPLVLERPPPR 22 >SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 37.1 bits (82), Expect = 0.012 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 71 FIHPNCPCSPGDPLV*ERPPPR 6 +I + CSPGDPLV ERPPPR Sbjct: 16 YIRESNSCSPGDPLVLERPPPR 37 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.1 bits (82), Expect = 0.012 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 65 HPNCPCSPGDPLV*ERPPPR 6 H + CSPGDPLV ERPPPR Sbjct: 24 HVSNSCSPGDPLVLERPPPR 43 >SB_42492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 37.1 bits (82), Expect = 0.012 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 65 HPNCPCSPGDPLV*ERPPPR 6 H + CSPGDPLV ERPPPR Sbjct: 4 HGSNSCSPGDPLVLERPPPR 23 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.1 bits (82), Expect = 0.012 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 65 HPNCPCSPGDPLV*ERPPPR 6 H + CSPGDPLV ERPPPR Sbjct: 16 HRSNSCSPGDPLVLERPPPR 35 >SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 37.1 bits (82), Expect = 0.012 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -1 Query: 71 FIHPNCPCSPGDPLV*ERPPPR 6 F+ + CSPGDPLV ERPPPR Sbjct: 11 FLSSSNSCSPGDPLVLERPPPR 32 >SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 37.1 bits (82), Expect = 0.012 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 65 HPNCPCSPGDPLV*ERPPPR 6 H + CSPGDPLV ERPPPR Sbjct: 24 HRSNSCSPGDPLVLERPPPR 43 >SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 37.1 bits (82), Expect = 0.012 Identities = 19/34 (55%), Positives = 21/34 (61%) Frame = -1 Query: 107 FWSKL*KT*IPIFIHPNCPCSPGDPLV*ERPPPR 6 FW L K +P + CSPGDPLV ERPPPR Sbjct: 35 FWKTLKKI-LPGEKKTSNSCSPGDPLVLERPPPR 67 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.1 bits (82), Expect = 0.012 Identities = 18/26 (69%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Frame = -1 Query: 80 IPIFIH-PNCPCSPGDPLV*ERPPPR 6 IP FI + CSPGDPLV ERPPPR Sbjct: 5 IPYFIMLASNSCSPGDPLVLERPPPR 30 >SB_18514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.1 bits (82), Expect = 0.012 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 65 HPNCPCSPGDPLV*ERPPPR 6 H + CSPGDPLV ERPPPR Sbjct: 10 HGSNSCSPGDPLVLERPPPR 29 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 36.7 bits (81), Expect = 0.015 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 65 HPNCPCSPGDPLV*ERPPPR 6 H + CSPGDPLV ERPPPR Sbjct: 161 HLSNSCSPGDPLVLERPPPR 180 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 36.7 bits (81), Expect = 0.015 Identities = 16/21 (76%), Positives = 16/21 (76%), Gaps = 1/21 (4%) Frame = -1 Query: 65 HPNC-PCSPGDPLV*ERPPPR 6 HP CSPGDPLV ERPPPR Sbjct: 67 HPRSNSCSPGDPLVLERPPPR 87 >SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 36.7 bits (81), Expect = 0.015 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 65 HPNCPCSPGDPLV*ERPPPR 6 H + CSPGDPLV ERPPPR Sbjct: 22 HLSNSCSPGDPLVLERPPPR 41 >SB_50729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.7 bits (81), Expect = 0.015 Identities = 18/29 (62%), Positives = 22/29 (75%) Frame = -3 Query: 87 NLNTNFYSSKLSLQPGGSTSLRAAATSID 1 +LN N SS LQPGGSTS RAAAT+++ Sbjct: 13 DLNYNIISSIEFLQPGGSTSSRAAATAVE 41 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.7 bits (81), Expect = 0.015 Identities = 17/27 (62%), Positives = 19/27 (70%), Gaps = 3/27 (11%) Frame = -1 Query: 77 PIFIHPNC---PCSPGDPLV*ERPPPR 6 PIF+ + CSPGDPLV ERPPPR Sbjct: 3 PIFVSNDAVSNSCSPGDPLVLERPPPR 29 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.7 bits (81), Expect = 0.015 Identities = 16/27 (59%), Positives = 20/27 (74%), Gaps = 2/27 (7%) Frame = -1 Query: 80 IPIFIHP--NCPCSPGDPLV*ERPPPR 6 +P ++ P + CSPGDPLV ERPPPR Sbjct: 4 LPFYLIPMVSNSCSPGDPLVLERPPPR 30 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.7 bits (81), Expect = 0.015 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -1 Query: 65 HPNCPCSPGDPLV*ERPPPR 6 H + CSPGDPLV ERPPPR Sbjct: 5 HISNSCSPGDPLVLERPPPR 24 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.7 bits (81), Expect = 0.015 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -1 Query: 74 IFIHPNCPCSPGDPLV*ERPPPR 6 +F+ + CSPGDPLV ERPPPR Sbjct: 1 MFVVRSNSCSPGDPLVLERPPPR 23 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.3 bits (80), Expect = 0.020 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 68 IHPNCPCSPGDPLV*ERPPPR 6 I+ + CSPGDPLV ERPPPR Sbjct: 19 INESNSCSPGDPLVLERPPPR 39 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 36.3 bits (80), Expect = 0.020 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -1 Query: 77 PIFIHPNCPCSPGDPLV*ERPPPR 6 P+ + + CSPGDPLV ERPPPR Sbjct: 256 PVTEYISNSCSPGDPLVLERPPPR 279 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.3 bits (80), Expect = 0.020 Identities = 16/23 (69%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -1 Query: 71 FIHPNC-PCSPGDPLV*ERPPPR 6 F+H CSPGDPLV ERPPPR Sbjct: 6 FMHTRSNSCSPGDPLVLERPPPR 28 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.3 bits (80), Expect = 0.020 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +2 Query: 2 SIEVAAALRLVDPPGCRDNLD 64 S VAAAL LVDPPGCR+++D Sbjct: 6 STAVAAALELVDPPGCRNSID 26 >SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 36.3 bits (80), Expect = 0.020 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +2 Query: 2 SIEVAAALRLVDPPGCRDNLD 64 S VAAAL LVDPPGCR+++D Sbjct: 6 STAVAAALELVDPPGCRNSID 26 >SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.3 bits (80), Expect = 0.020 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 68 IHPNCPCSPGDPLV*ERPPPR 6 I+ + CSPGDPLV ERPPPR Sbjct: 13 INSSNSCSPGDPLVLERPPPR 33 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 36.3 bits (80), Expect = 0.020 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +2 Query: 2 SIEVAAALRLVDPPGCRDNLD 64 S VAAAL LVDPPGCR+++D Sbjct: 6 STAVAAALELVDPPGCRNSMD 26 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 36.3 bits (80), Expect = 0.020 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +2 Query: 2 SIEVAAALRLVDPPGCRDNLD 64 S VAAAL LVDPPGCR+++D Sbjct: 23 STAVAAALELVDPPGCRNSID 43 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 36.3 bits (80), Expect = 0.020 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = +2 Query: 2 SIEVAAALRLVDPPGCRDNLDE*KLVFRFFTVWTK 106 S VAAAL LVDPPGCR+++ K F +WT+ Sbjct: 6 STAVAAALELVDPPGCRNSI---KYGQEEFQIWTR 37 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 36.3 bits (80), Expect = 0.020 Identities = 16/25 (64%), Positives = 19/25 (76%) Frame = -1 Query: 80 IPIFIHPNCPCSPGDPLV*ERPPPR 6 + +F+ N CSPGDPLV ERPPPR Sbjct: 61 LTVFMLSNS-CSPGDPLVLERPPPR 84 >SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) Length = 545 Score = 36.3 bits (80), Expect = 0.020 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 68 IHPNCPCSPGDPLV*ERPPPR 6 I+ + CSPGDPLV ERPPPR Sbjct: 250 INASNSCSPGDPLVLERPPPR 270 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 36.3 bits (80), Expect = 0.020 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 77 PIFIHPNCPCSPGDPLV*ERPPPR 6 PI + CSPGDPLV ERPPPR Sbjct: 19 PIVEKRSNSCSPGDPLVLERPPPR 42 >SB_26132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 36.3 bits (80), Expect = 0.020 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -1 Query: 71 FIHPNCPCSPGDPLV*ERPPPR 6 FI N CSPGDPLV ERPPPR Sbjct: 65 FIGSNS-CSPGDPLVLERPPPR 85 >SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 36.3 bits (80), Expect = 0.020 Identities = 24/49 (48%), Positives = 28/49 (57%) Frame = -1 Query: 152 ISNR*VL*TRVVI*KFWSKL*KT*IPIFIHPNCPCSPGDPLV*ERPPPR 6 I N+ +R+ K SKL KT I + CSPGDPLV ERPPPR Sbjct: 13 IQNKLQTISRIRAYKNCSKLNKT----AIKASNSCSPGDPLVLERPPPR 57 >SB_23020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.3 bits (80), Expect = 0.020 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -1 Query: 71 FIHPNCPCSPGDPLV*ERPPPR 6 F H + CSPGDPLV ERPPPR Sbjct: 3 FTHAHS-CSPGDPLVLERPPPR 23 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.3 bits (80), Expect = 0.020 Identities = 16/23 (69%), Positives = 18/23 (78%) Frame = -1 Query: 74 IFIHPNCPCSPGDPLV*ERPPPR 6 +F+ N CSPGDPLV ERPPPR Sbjct: 14 VFLISNS-CSPGDPLVLERPPPR 35 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 36.3 bits (80), Expect = 0.020 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +2 Query: 2 SIEVAAALRLVDPPGCRDNLD 64 S VAAAL LVDPPGCR+++D Sbjct: 69 STAVAAALELVDPPGCRNSMD 89 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 15 CSPGDPLVLERPPPR 29 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 13 CSPGDPLVLERPPPR 27 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 38 CSPGDPLVLERPPPR 52 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 29 CSPGDPLVLERPPPR 43 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 6 CSPGDPLVLERPPPR 20 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 21 CSPGDPLVLERPPPR 35 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 82 CSPGDPLVLERPPPR 96 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 18 CSPGDPLVLERPPPR 32 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 352 CSPGDPLVLERPPPR 366 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 10 CSPGDPLVLERPPPR 24 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 9 CSPGDPLVLERPPPR 23 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 14 CSPGDPLVLERPPPR 28 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 105 CSPGDPLVLERPPPR 119 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 34 CSPGDPLVLERPPPR 48 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 10 CSPGDPLVLERPPPR 24 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 38 CSPGDPLVLERPPPR 52 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 35.9 bits (79), Expect = 0.027 Identities = 18/34 (52%), Positives = 22/34 (64%) Frame = +2 Query: 2 SIEVAAALRLVDPPGCRDNLDE*KLVFRFFTVWT 103 S VAAAL LVDPPGCR+++ KL +WT Sbjct: 6 STAVAAALELVDPPGCRNSIS--KLCKDLDEIWT 37 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 7 CSPGDPLVLERPPPR 21 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 85 CSPGDPLVLERPPPR 99 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 5 CSPGDPLVLERPPPR 19 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 519 CSPGDPLVLERPPPR 533 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 385 CSPGDPLVLERPPPR 399 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 27 CSPGDPLVLERPPPR 41 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 34 CSPGDPLVLERPPPR 48 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 5 CSPGDPLVLERPPPR 19 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 11 CSPGDPLVLERPPPR 25 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 25 CSPGDPLVLERPPPR 39 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 22 CSPGDPLVLERPPPR 36 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 6 CSPGDPLVLERPPPR 20 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 20 CSPGDPLVLERPPPR 34 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 10 CSPGDPLVLERPPPR 24 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 57 CSPGDPLVLERPPPR 71 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 7 CSPGDPLVLERPPPR 21 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 28 CSPGDPLVLERPPPR 42 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 22 CSPGDPLVLERPPPR 36 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 14 CSPGDPLVLERPPPR 28 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 14 CSPGDPLVLERPPPR 28 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 22 CSPGDPLVLERPPPR 36 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 16 CSPGDPLVLERPPPR 30 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 23 CSPGDPLVLERPPPR 37 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 20 CSPGDPLVLERPPPR 34 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 21 CSPGDPLVLERPPPR 35 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 19 CSPGDPLVLERPPPR 33 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 8 CSPGDPLVLERPPPR 22 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 7 CSPGDPLVLERPPPR 21 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 14 CSPGDPLVLERPPPR 28 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 51 CSPGDPLVLERPPPR 65 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 16 CSPGDPLVLERPPPR 30 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 116 CSPGDPLVLERPPPR 130 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 896 CSPGDPLVLERPPPR 910 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 17 CSPGDPLVLERPPPR 31 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 28 CSPGDPLVLERPPPR 42 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 17 CSPGDPLVLERPPPR 31 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 97 CSPGDPLVLERPPPR 111 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 68 CSPGDPLVLERPPPR 82 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 18 CSPGDPLVLERPPPR 32 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 879 CSPGDPLVLERPPPR 893 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 10 CSPGDPLVLERPPPR 24 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 14 CSPGDPLVLERPPPR 28 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 66 CSPGDPLVLERPPPR 80 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 8 CSPGDPLVLERPPPR 22 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 23 CSPGDPLVLERPPPR 37 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 67 CSPGDPLVLERPPPR 81 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 46 CSPGDPLVLERPPPR 60 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 29 CSPGDPLVLERPPPR 43 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 42 CSPGDPLVLERPPPR 56 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 18 CSPGDPLVLERPPPR 32 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 24 CSPGDPLVLERPPPR 38 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 27 CSPGDPLVLERPPPR 41 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 44 CSPGDPLVLERPPPR 58 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 6 CSPGDPLVLERPPPR 20 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 43 CSPGDPLVLERPPPR 57 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 28 CSPGDPLVLERPPPR 42 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 18 CSPGDPLVLERPPPR 32 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 145 CSPGDPLVLERPPPR 159 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 486 CSPGDPLVLERPPPR 500 >SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 5 CSPGDPLVLERPPPR 19 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 38 CSPGDPLVLERPPPR 52 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 84 CSPGDPLVLERPPPR 98 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 39 CSPGDPLVLERPPPR 53 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 64 CSPGDPLVLERPPPR 78 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 27 CSPGDPLVLERPPPR 41 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 7 CSPGDPLVLERPPPR 21 >SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 7 CSPGDPLVLERPPPR 21 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 57 CSPGDPLVLERPPPR 71 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 10 CSPGDPLVLERPPPR 24 >SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 5 CSPGDPLVLERPPPR 19 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 26 CSPGDPLVLERPPPR 40 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 25 CSPGDPLVLERPPPR 39 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 37 CSPGDPLVLERPPPR 51 >SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 5 CSPGDPLVLERPPPR 19 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 207 CSPGDPLVLERPPPR 221 >SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 50 CSPGDPLVLERPPPR 64 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 17 CSPGDPLVLERPPPR 31 >SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 5 CSPGDPLVLERPPPR 19 >SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 6 CSPGDPLVLERPPPR 20 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 1025 CSPGDPLVLERPPPR 1039 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 20 CSPGDPLVLERPPPR 34 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 20 CSPGDPLVLERPPPR 34 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 124 CSPGDPLVLERPPPR 138 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 20 CSPGDPLVLERPPPR 34 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 7 CSPGDPLVLERPPPR 21 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 26 CSPGDPLVLERPPPR 40 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 15 CSPGDPLVLERPPPR 29 >SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 11 CSPGDPLVLERPPPR 25 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 66 CSPGDPLVLERPPPR 80 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 26 CSPGDPLVLERPPPR 40 >SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 12 CSPGDPLVLERPPPR 26 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 8 CSPGDPLVLERPPPR 22 >SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) Length = 725 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 195 CSPGDPLVLERPPPR 209 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 46 CSPGDPLVLERPPPR 60 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 27 CSPGDPLVLERPPPR 41 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 33 CSPGDPLVLERPPPR 47 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 42 CSPGDPLVLERPPPR 56 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 25 CSPGDPLVLERPPPR 39 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 42 CSPGDPLVLERPPPR 56 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 19 CSPGDPLVLERPPPR 33 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 20 CSPGDPLVLERPPPR 34 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 63 CSPGDPLVLERPPPR 77 >SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 9 CSPGDPLVLERPPPR 23 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 87 CSPGDPLVLERPPPR 101 >SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 16 CSPGDPLVLERPPPR 30 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 22 CSPGDPLVLERPPPR 36 >SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 8 CSPGDPLVLERPPPR 22 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 7 CSPGDPLVLERPPPR 21 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 22 CSPGDPLVLERPPPR 36 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 13 CSPGDPLVLERPPPR 27 >SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) Length = 174 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 54 CSPGDPLVLERPPPR 68 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 44 CSPGDPLVLERPPPR 58 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 14 CSPGDPLVLERPPPR 28 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 12 CSPGDPLVLERPPPR 26 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 121 CSPGDPLVLERPPPR 135 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 70 CSPGDPLVLERPPPR 84 >SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) Length = 365 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 245 CSPGDPLVLERPPPR 259 >SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 16 CSPGDPLVLERPPPR 30 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 35.9 bits (79), Expect = 0.027 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 50 CSPGDPLV*ERPPPR 6 CSPGDPLV ERPPPR Sbjct: 188 CSPGDPLVLERPPPR 202 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,876,733 Number of Sequences: 59808 Number of extensions: 274803 Number of successful extensions: 2674 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2647 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2671 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -