BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0543 (653 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59124| Best HMM Match : Bac_luciferase (HMM E-Value=1.6) 29 4.4 SB_59326| Best HMM Match : FtsX (HMM E-Value=2.2) 28 7.6 SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_59124| Best HMM Match : Bac_luciferase (HMM E-Value=1.6) Length = 1953 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = +2 Query: 503 TTQRLSVTLTYRIK*GLICRSTLNYY 580 TT+RLSVTLT ++ +IC ST+ +Y Sbjct: 911 TTRRLSVTLTTKVF-LMICASTITHY 935 >SB_59326| Best HMM Match : FtsX (HMM E-Value=2.2) Length = 238 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/51 (25%), Positives = 29/51 (56%) Frame = +2 Query: 173 WTQLKVLLRFNLTFIVSIRLLSTFEYILFQLLVVIRGNFKIILTTVVIIKL 325 +T + ++ T I+ I +++ I+ ++++I II+TT+VII + Sbjct: 156 FTIIIIITTTTTTIIIIIIIINIIIIIITIIIIIIATTIVIIVTTIVIISI 206 >SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3259 Score = 27.9 bits (59), Expect = 7.6 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 5/48 (10%) Frame = +2 Query: 197 RFNLTFIVSIRLLSTFEY---ILFQLLVVIRGNFKI--ILTTVVIIKL 325 R L VS+R++ F Y + QLL++I GN+ +LT + I L Sbjct: 27 RHVLALRVSVRVIRIFAYFGQVFLQLLILITGNYNFFNLLTMTLCISL 74 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,935,649 Number of Sequences: 59808 Number of extensions: 313290 Number of successful extensions: 637 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 631 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -