BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0543 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 pr... 24 4.8 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 23 6.4 >AY748829-1|AAV28177.1| 105|Anopheles gambiae cytochrome P450 protein. Length = 105 Score = 23.8 bits (49), Expect = 4.8 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 558 QMSPYLMRYVNVTDNRWVVSSATYRQKVKVY 466 Q PYL V+ T RW +++ R+ V+ Y Sbjct: 2 QSLPYLDMVVSETLRRWPIATVLNRECVRNY 32 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 23.4 bits (48), Expect = 6.4 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -3 Query: 543 LMRYVNVTDNRWVVSSATYRQKVK 472 ++RY T RWV+ T+R+ V+ Sbjct: 782 IIRYGVATWGRWVLDKETHRKSVQ 805 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 588,668 Number of Sequences: 2352 Number of extensions: 10581 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -