BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= prgv0543 (653 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49911-9|CAA90133.1| 682|Caenorhabditis elegans Hypothetical pr... 28 6.7 Z92785-1|CAB07199.2| 299|Caenorhabditis elegans Hypothetical pr... 27 8.8 >Z49911-9|CAA90133.1| 682|Caenorhabditis elegans Hypothetical protein M28.7 protein. Length = 682 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = +1 Query: 427 YYFKGAKQLIQKNVHFNLLSIRRGTDNPTIIGYINISH*VRTHLPIYSKLL 579 +YF+ + + + F+ +R +PT++ + SH V+T + I K L Sbjct: 417 WYFEKKESQTRSCIEFSDFVLRSNYRSPTVVLVVEASHLVKTQIGIEEKSL 467 >Z92785-1|CAB07199.2| 299|Caenorhabditis elegans Hypothetical protein F31E9.2 protein. Length = 299 Score = 27.5 bits (58), Expect = 8.8 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +2 Query: 182 LKVLLRFNLTFIVSIRLLSTFEYILFQLLVV--IRGNFKIILTTVVI 316 L L+ + LTF+V +R TF+ FQL V I F I+ VVI Sbjct: 16 LPSLILYILTFVVILRHRKTFDSSFFQLYVFDGIMNLFTYIMGFVVI 62 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,005,725 Number of Sequences: 27780 Number of extensions: 247066 Number of successful extensions: 538 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 532 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 538 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1455289764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -